KEGG   Streptococcus sp. VT 162: V470_09655Help
Entry
V470_09655        CDS       T03287                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stv  Streptococcus sp. VT 162
Pathway
stv00071  Fatty acid degradation
stv00072  Synthesis and degradation of ketone bodies
stv00280  Valine, leucine and isoleucine degradation
stv00310  Lysine degradation
stv00362  Benzoate degradation
stv00620  Pyruvate metabolism
stv00630  Glyoxylate and dicarboxylate metabolism
stv00640  Propanoate metabolism
stv00650  Butanoate metabolism
stv00900  Terpenoid backbone biosynthesis
stv01100  Metabolic pathways
stv01110  Biosynthesis of secondary metabolites
stv01120  Microbial metabolism in diverse environments
stv01130  Biosynthesis of antibiotics
stv01200  Carbon metabolism
stv01212  Fatty acid metabolism
stv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    V470_09655
   00630 Glyoxylate and dicarboxylate metabolism
    V470_09655
   00640 Propanoate metabolism
    V470_09655
   00650 Butanoate metabolism
    V470_09655
  09103 Lipid metabolism
   00071 Fatty acid degradation
    V470_09655
   00072 Synthesis and degradation of ketone bodies
    V470_09655
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    V470_09655
   00310 Lysine degradation
    V470_09655
   00380 Tryptophan metabolism
    V470_09655
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    V470_09655
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    V470_09655
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V470_09655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stv04147]
    V470_09655
Enzymes [BR:stv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     V470_09655
Exosome [BR:stv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   V470_09655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHZ48669
UniProt: A0A024DGT0
Position
complement(1954049..1955227)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVSAVRTPIGSFGGSLKNVSAVDLGALVIKSALEKANVKPELVDEVIMGNVLGAG
LGQNVARQMSIHAGLPESTPAFTINKVCGSGLKAVQLAAQAIRCGDADIIVTGGAENMSQ
APYVLPSFRWGGRMGDSKVVDTMIKDGLSDAFNEYHMGITAENVAEEYGVSREEQDALAL
ESQKRAVAAIESGHFKEEIVPVVIPQLKGDPIVFDTDEYPRKDASLESLSKLGPVFKKDG
SVTAGNASGINDGAAAVLVMSAEKAEELGLSVIARIRSYASAGLDPKMMGCGPIYATRKA
LEKGNLTVEDLDLIESNEAFAAQACAVGKTLGFNTDIVNVNGGAIALGHPIGASGCRILV
TLLHEMMKRDAKTGLATLCIGGGMGTALIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgtggtgattgtttcggcagtgcgaactccaataggctcctttggaggaagt
ttgaagaatgtttcagctgttgatttgggagctttggttattaagagtgctttagaaaaa
gccaatgtcaaaccagagctagtagacgaagtgattatggggaatgtcctaggcgctggt
ttagggcaaaatgtggctcgccaaatgagcattcatgcgggacttccggaatctacacca
gcctttaccatcaataaggtttgtggttccggtttgaaggccgtgcagttggctgctcaa
gcgattcgatgtggcgatgcagatattatcgtaactggtggtgcagaaaacatgagtcag
gctccatacgttttgccaagctttcgttggggtggccgtatgggagattcaaaagtggta
gataccatgattaaggacggtttgtctgatgcctttaatgaataccatatggggattaca
gctgaaaatgtggccgaagaatatggtgtcagtagagaagagcaagatgctcttgcttta
gagtcacaaaaacgagcagttgcagctatagaatctggacactttaaagaagagattgtg
ccagttgtcattcctcaactcaaaggcgatcctatcgtttttgatacagatgaatatcct
agaaaagatgctagcttggagagcttgtctaagctaggtccggttttcaaaaaagacggt
tctgtcacagcgggaaatgcttcaggtatcaatgatggagcagcggctgtcttggtcatg
agcgctgaaaaagcggaagaattagggctttcagtgattgcccgcattcgttcgtatgca
agtgcaggtttggatcctaagatgatgggatgtggaccgatttatgcgactcgcaaggct
cttgaaaaaggcaatttgacagttgaagatctcgacttgattgagtcaaatgaagctttt
gctgctcaggcttgtgcggttggtaaaacacttggtttcaacacagatattgtcaatgtc
aatggtggcgccattgctcttggtcacccaattggggcttccggttgccgtatcctagta
acgctgctacatgagatgatgaaacgtgatgctaaaactggtttagctactctctgtatc
ggaggagggatgggaacagccctcatcgttgaacgttag

DBGET integrated database retrieval system