KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C0047Help
Entry
Y1U_C0047         CDS       T02116                                 

Definition
(GenBank) Arginyl-tRNA synthetase, putative
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
stw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:stw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Y1U_C0047
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stw01007]
    Y1U_C0047
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:stw03016]
    Y1U_C0047
   03029 Mitochondrial biogenesis [BR:stw03029]
    Y1U_C0047
Enzymes [BR:stw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Y1U_C0047
Amino acid related enzymes [BR:stw01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Y1U_C0047
Transfer RNA biogenesis [BR:stw03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Y1U_C0047
 Prokaryotic Type
   Other AARSs
    Y1U_C0047
Mitochondrial biogenesis [BR:stw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Y1U_C0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N AvrM-A
Motif
Other DBs
NCBI-ProteinID: AFJ82496
Position
complement(51765..53456)
Genome map
AA seq 563 aa AA seqDB search
MNTKELIAAEIAKVVPELEQENIQNLLEIPKNADMGDLAFPAFSLAKVLRKAPQMIAADI
AEKIDASNFEKVEAVGPYINIFLDKSKISADVLGQVIAQGSHYADQNIGNGRNIAFDMSS
PNIAKPFSIGHLRSTVIADALANIVAKQGYKPVRINHLGDWGKQFGMLIVAYKKWGSEEA
VKANPINELLQLYVRINAEAEEDPSVDEEAREWFRKLEAGDEEATALWQWFRDESLVEFN
RLYDELGVSFDSYNGEAFYNDKMDEVVDILTEKGLLQESQGAQVVNLEKYGIEHPALIKK
SDGATLYITRDLAAALYRKRTYDFAKAIYVVGNEQSAHFKQLKAVLKEMGYNWSDDMTHV
AFGLVTKNGKKLSTRKGNVILLEPTIAEAVNRAQAQIEAKNPNLPNKEAIAHAVGVGAIK
FYDLKTDRMNGYDFDLDAMVSFEGETGPYVQYAHARIQSILRKADFTPSADATYSLNDVE
SWEIIKLLQDFPRIINRASDNFEPSIVAKFAISLAQAFNKYYAHTRILDESPERDSRLAL
CYATATVLKEALRLLGVEAPDEM
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaatactaaagaactcattgcagcagaaattgctaaagttgttcctgagttggaacaa
gaaaacattcaaaatctgcttgaaatccctaaaaatgctgacatgggagacctcgccttt
cctgccttctcattggcaaaagtcttgcgcaaggctcctcaaatgattgcagcagacatc
gctgaaaaaattgatgcctcaaactttgaaaaagttgaagctgttggtccttatattaac
atcttcctcgataaatcaaaaatttcagcggacgttcttggacaagtcatcgctcaaggt
agccactacgctgaccaaaacatcggtaacggacgtaatattgcctttgatatgtctagt
cctaacatcgccaaacctttctctatcggtcacttgcgttcaacggttatcgctgatgct
cttgccaacatcgtagctaaacaaggttacaaaccagtccgcatcaatcacttgggcgac
tggggtaaacaatttggtatgcttattgttgcctataagaaatggggtagcgaggaagct
gtcaaagccaatcctatcaatgaactccttcaactttatgtgcgtatcaatgccgaagct
gaagaagacccatctgtagacgaagaagctcgtgaatggttccgtaaattggaagctggt
gatgaggaagcaactgccctctggcaatggttccgtgacgaaagcttagtggaattcaac
cgtctctacgatgaacttggtgtttcatttgatagctacaatggtgaagctttctacaat
gataagatggatgaagtcgtagacattttgacagagaaaggacttctccaagaatctcaa
ggtgcccaagtggttaaccttgaaaaatacggtatcgaacacccagccctcatcaaaaaa
tcagatggtgcaacactctacatcacacgtgacttggctgctgccctctaccgtaaacgt
acttatgattttgccaaagccatctatgtagttggtaatgaacaatctgcccacttcaaa
cagttgaaagctgttcttaaagaaatgggctataactggtctgacgacatgactcacgtt
gcctttggtcttgtaactaagaacggtaagaaattgtcgactcgtaaaggtaacgttatc
ttgcttgagccaactatcgctgaggctgttaaccgtgcccaagctcaaatcgaagctaag
aatccaaacttacctaacaaggaagctattgctcacgctgttggtgttggagctatcaag
ttctacgaccttaaaacagaccgcatgaatggttatgactttgatcttgatgctatggta
tctttcgaaggggaaactgggccttacgttcaatatgcacacgctcgtatccaatctatc
ttgcgcaaggctgacttcacgccatctgcagatgctacatacagcttaaacgacgttgaa
agctgggaaatcatcaaactcttacaagacttcccacgtatcatcaaccgtgcatcagac
aactttgaaccatctatcgttgctaaatttgctatcagcttggctcaagcctttaacaaa
tactatgcgcacacacgtatcttggacgaaagcccagaacgtgacagccgtttggctctt
tgctacgcaacagcaacagtcctcaaagaagcccttcgccttctcggtgttgaagctcca
gacgaaatgtaa

DBGET integrated database retrieval system