KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C1108Help
Entry
Y1U_C1108         CDS       T02116                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
stw00010  Glycolysis / Gluconeogenesis
stw00260  Glycine, serine and threonine metabolism
stw00680  Methane metabolism
stw01100  Metabolic pathways
stw01110  Biosynthesis of secondary metabolites
stw01120  Microbial metabolism in diverse environments
stw01130  Biosynthesis of antibiotics
stw01200  Carbon metabolism
stw01230  Biosynthesis of amino acids
Module
stw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stw_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y1U_C1108
  Energy metabolism
   00680 Methane metabolism
    Y1U_C1108
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Y1U_C1108
Enzymes [BR:stw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Y1U_C1108
Membrane trafficking [BR:stw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Y1U_C1108
Exosome [BR:stw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Y1U_C1108
  Exosomal proteins of melanoma cells
   Y1U_C1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFJ83557
Position
complement(1079716..1080408)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDKAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPKMDRDDEYSAHKDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKKLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtctgaatggaacaaagctaatcttttc
acaggttgggctgacgtagatctttctgaaaaaggtactcaacaagctattgacgctggt
aaattgattaaagaagctggtattgaatttgacaaagcttacacttcagtattgaaacgt
gcgatcaaaacaactaaccttgcgcttgaagcctctgaccaactttgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaataaagcagaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaaaatggaccgtgatgatgagtactcagcacacaaagaccgtcgttacgcttca
cttgacgattcagtaattccagatgctgaaaacttgaaagtaactttggaacgtgccctt
ccattctgggaagataaaattgctccagctcttaaagatggtaaaaacgtattcgtaggt
gcacatggtaactcaatccgtgcccttgtaaaacacatcaaaaaattgtcagatgacgaa
atcatggatgttgaaattccaaacttcccaccattggtatttgaatttgacgaaaaattg
aacgttgtttctgaatattacctcggaaaataa

DBGET integrated database retrieval system