KEGG   Streptococcus thermophilus MN-ZLW-002: Y1U_C1481Help
Entry
Y1U_C1481         CDS       T02116                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
stw  Streptococcus thermophilus MN-ZLW-002
Pathway
stw00260  Glycine, serine and threonine metabolism
stw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stw01100  Metabolic pathways
stw01110  Biosynthesis of secondary metabolites
stw01130  Biosynthesis of antibiotics
stw01230  Biosynthesis of amino acids
Module
stw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Y1U_C1481
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Y1U_C1481
Enzymes [BR:stw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Y1U_C1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFJ83930
Position
complement(1446952..1447734)
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLQAIKDSKRGIFVPYIMAGDHAKGLDGLFETITLLENSGVSAIEVGIPWSDP
VADGPIIELAGQRSLAKDVTLTAIIKKLQEKKTQVPLVIMTYINPVYQYGIEAFVKDLAE
TSVKGLIIPDLPNEHADFITPYLRDSDIALVPLVSLTTGIDRQKQLIDGAEGFIYAVAIN
GVTGKTGNYRDDLDKHLSNLTAYADIPVLTGFGVSTEEDIKRFNAVSDGVIVGSKIVRDL
HDGKEEEVAEFVTLGSHFEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacactaacaaaacatctacaagctatcaaagacagtaaacgcggtattttc
gtgccctatatcatggctggtgaccacgctaaaggtctagacggactctttgagactatt
actctcttagaaaatagcggtgtttcagctatcgaggtgggtattccatggtctgaccca
gtggctgatggtcccattattgaactagcaggacaacgtagtttggctaaagacgtgact
ttaacagctatcatcaagaagcttcaagaaaaaaagacacaggtgcctttggttatcatg
acctacatcaacccagtttatcagtatggtattgaagcctttgtcaaagatttagcagag
acttctgtcaaggggctcatcattcctgatttgccaaatgaacatgctgactttatcact
ccttatttgagagacagtgacattgctctcgtgcctttggtcagcttgactacaggcatt
gatcgtcagaaacagttgattgatggtgcagaaggctttatctacgccgttgccatcaat
ggtgttactggtaagactggtaattaccgtgatgaccttgataaacacttatctaacttg
actgcctatgcagacattccagttctcacaggttttggtgtgtcaacagaggaagacatt
aaacgctttaatgctgtgtcagacggtgttatcgtgggatcaaaaattgtccgtgacctg
cacgacggtaaggaagaagaagtcgctgaatttgttacattaggttcacattttgaaaaa
tag

DBGET integrated database retrieval system