KEGG   Streptococcus pyogenes MGAS1882 (serotype M59): MGAS1882_0155Help
Entry
MGAS1882_0155     CDS       T02062                                 

Gene name
atoB.1
Definition
(GenBank) acetyl-CoA acetyltransferase AtoB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stx  Streptococcus pyogenes MGAS1882 (serotype M59)
Pathway
stx00071  Fatty acid degradation
stx00072  Synthesis and degradation of ketone bodies
stx00280  Valine, leucine and isoleucine degradation
stx00310  Lysine degradation
stx00362  Benzoate degradation
stx00380  Tryptophan metabolism
stx00620  Pyruvate metabolism
stx00630  Glyoxylate and dicarboxylate metabolism
stx00640  Propanoate metabolism
stx00650  Butanoate metabolism
stx00900  Terpenoid backbone biosynthesis
stx01100  Metabolic pathways
stx01110  Biosynthesis of secondary metabolites
stx01120  Microbial metabolism in diverse environments
stx01130  Biosynthesis of antibiotics
stx01200  Carbon metabolism
stx01212  Fatty acid metabolism
stx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS1882_0155 (atoB.1)
   00630 Glyoxylate and dicarboxylate metabolism
    MGAS1882_0155 (atoB.1)
   00640 Propanoate metabolism
    MGAS1882_0155 (atoB.1)
   00650 Butanoate metabolism
    MGAS1882_0155 (atoB.1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MGAS1882_0155 (atoB.1)
   00072 Synthesis and degradation of ketone bodies
    MGAS1882_0155 (atoB.1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGAS1882_0155 (atoB.1)
   00310 Lysine degradation
    MGAS1882_0155 (atoB.1)
   00380 Tryptophan metabolism
    MGAS1882_0155 (atoB.1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS1882_0155 (atoB.1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGAS1882_0155 (atoB.1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MGAS1882_0155 (atoB.1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stx04147]
    MGAS1882_0155 (atoB.1)
Enzymes [BR:stx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGAS1882_0155 (atoB.1)
Exosome [BR:stx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAS1882_0155 (atoB.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AFC67393
Position
128632..129816
Genome map
AA seq 394 aa AA seqDB search
MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLKSDAIDEVIFGNVLHA
GLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQTGNADIVLVGGTENMS
QAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAENIVQQYGLTREEQDAFA
ADSQRKAQFAIEKGRFKEEIAPVTIPQRKGEPLLVDQDEYPKFGTTVDKLAKLRPAFIKD
EGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSYASAGVDPSIMGCGPIPATK
KALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKVNVNGGAIALGHPIGASGARI
LVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaagtggtgatcacatctgcttatcgtaccccgataggaaattttggagga
gtctttaaatctttatcagccgtagatttgggggtgacagttgttacaaaaattttagct
gataccggtcttaaaagtgatgccattgatgaagtgatctttgggaatgtgttacatgca
ggtctgggtcaaaatgttgctcggcaagtagcgctaaatgcggggctttcttatgatacc
cctgcttttacgattgatatggtctgtggttctggcttaaaagcagttgagttaggtgct
caaaagattcaaacgggcaacgctgatattgttttagtcggtggtaccgaaaacatgagt
caagcaccttacgttttacaaggccaacgttggggatctcgtatgggagatagtaaagta
gtagataccatgcttaaagatgggttgagtgatgcttttgcaggttatcacatgggtata
acagccgaaaatattgtgcaacagtatggactgaccagagaagaacaagatgcctttgca
gctgatagccaacgtaaagcccaatttgccatagaaaaaggtcgtttcaaagaagagatt
gcacctgtcactattcctcagcgtaaaggtgaacctttactcgttgatcaagatgaatac
cctaaatttggaacgacagtggataagttagcaaagttacgccctgcttttatcaaagat
gaggggacagtaactgctggtaatgcttcaggaatcaatgatggagcagcggcaatttta
ttgatgagtaaagaaaaagctgaagaattagggctccctattttagctaaaatcactagt
tatgcaagtgcaggtgtagacccaagtattatgggctgcggaccaatacctgctacgaaa
aaggctcttgcaaaggctcagctgacaattgatgacattgatttgattgaagcaaacgaa
gcttttgctgctcaggctttagcggtttcacgagaccttggttttgacaatgaaaaagtt
aatgtcaatggaggagctattgctttgggtcacccgattggagcatcaggtgctcgtatt
ttagtcaccttattagcagaaatggctaagcgtgatgtgagacatggcttagcaacgctt
tgtattggtggtggccaaggtcaaagtatcatcgtaacaagatag

DBGET integrated database retrieval system