KEGG   Streptococcus pyogenes MGAS1882 (serotype M59): MGAS1882_0776Help
Entry
MGAS1882_0776     CDS       T02062                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoamide acetyltransferase E2 subunit AcoC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
stx  Streptococcus pyogenes MGAS1882 (serotype M59)
Pathway
stx00010  Glycolysis / Gluconeogenesis
stx00020  Citrate cycle (TCA cycle)
stx00620  Pyruvate metabolism
stx01100  Metabolic pathways
stx01110  Biosynthesis of secondary metabolites
stx01120  Microbial metabolism in diverse environments
stx01130  Biosynthesis of antibiotics
stx01200  Carbon metabolism
Module
stx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:stx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS1882_0776 (acoC)
   00020 Citrate cycle (TCA cycle)
    MGAS1882_0776 (acoC)
   00620 Pyruvate metabolism
    MGAS1882_0776 (acoC)
Enzymes [BR:stx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MGAS1882_0776 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B
Motif
Other DBs
NCBI-ProteinID: AFC67990
Position
757726..759135
Genome map
AA seq 469 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDILLEIMSDKTNMELEAEDSGVLLKIV
RPAGDTVSVTEVIGYIGAEGESVDTIASSEKTTEIPVPASADAGPAVAPKENVASPAPQV
AATAIPQGNGGKVRATPAARKVAAEMGIDLGQVPGTGPKGRVHKEDVENFKGAQPKASPL
ARKIAADKGIDLATVSGTGFNGKVMKEDIMAILEAAKPAEAKAPAAKEEKVVDLPEGVEH
KPMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRRKLIDPIMAKTGLKVSFTDLI
GMAVVKTLMKPEHEYMNASLINDANDIELHRFVNLGIAVGLDDGLIVPVIHGADKMSLSD
FVLASKDVIKKAQTGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPT
PTVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaattattatgccaaagctgggcgttgacatgcaagaaggcgagatcatc
gagtggaaaaaacaagaaggtgataccgtcaatgaaggtgatatccttcttgaaatcatg
tcagacaaaaccaatatggaacttgaggcagaagactcaggtgtgctattgaaaattgtc
cgtccagctggtgatactgtatctgtaactgaagttatcggttacattggtgcagagggt
gaatcagtagatactattgcttcaagtgaaaaaacaacagaaattccagttcctgcttca
gcagacgctggaccagcagttgctccaaaagaaaatgtggcaagtccagctcctcaagtg
gcagcgacagctattccgcaaggaaatggcggaaaagttcgtgctactccagctgcacgt
aaggtagcagcagaaatgggcattgaccttggccaagttccaggaacaggaccaaaagga
cgtgtccataaagaagacgttgaaaactttaaaggtgctcaaccgaaagcttcaccactt
gctcgtaaaattgcagcagacaaaggtattgatttggcaaccgtatcaggtactggcttt
aacggtaaggtcatgaaagaagacatcatggctattcttgaagcggctaaaccagctgaa
gcaaaagccccagcagctaaagaagaaaaagttgttgatcttccagaaggtgtggaacac
aagccaatgtcagctatgcgtaaggcaatctctaaaggtatgacaaactcttaccttact
gctcctacctttacgcttaactacgatattgacatgacagagatgattgcccttcgtagg
aagttaattgacccaatcatggctaaaacaggccttaaagtcagcttcacagacttgatt
ggtatggcagtggttaaaaccttgatgaaacctgagcatgagtacatgaatgcttccctc
atcaatgatgctaatgatattgaattacaccgctttgtgaaccttggtattgccgtaggt
cttgatgatggtcttattgttcctgttatccatggggctgacaagatgagcttgtcagat
tttgtgcttgcttcaaaagatgtgattaaaaaagcgcaaactggtaagttgaaggcagct
gaaatgtctggatcaaccttctctatcacaaacttgggaatgtttggtacgaagacattt
aacccaattattaaccaaccaaactcagcaattcttggtgttggagcaactatcccaact
ccaacggttgtggatggtgagattgttgcccgcccaattatggcaatgtgcctaaccatc
gaccaccgtttagttgatggtatgaacggtgcaaaattcatggttgatctcaagaaattg
atggaaaatccatttgaattgttaatctga

DBGET integrated database retrieval system