KEGG   Streptococcus pyogenes MGAS1882 (serotype M59): MGAS1882_1093Help
Entry
MGAS1882_1093     CDS       T02062                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
stx  Streptococcus pyogenes MGAS1882 (serotype M59)
Pathway
stx03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:stx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MGAS1882_1093 (recR)
DNA repair and recombination proteins [BR:stx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     MGAS1882_1093 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MGAS1882_1093 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: AFC68300
Position
complement(1090920..1091516)
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCHICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPD
DINLKSLITRLMDGKVSEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgctttatccaacacccattgcaaagttaattgacagttactctaaacttccaggaatt
ggtatcaagacggcgacgagattagccttttatactattggaatgtcaaatgaagatgtc
aatgattttgctaaaaacttattagcagctaaaagagaactgacctattgttcgatttgt
ggaaaccttaccgatgacgatccttgtcacatttgcacagacacgagtcgtgatcagacg
accattctggtagtagaagatgctaaagatgtttctgccatggaaaaaatccaagagtat
catggctattatcatgtgcttcacggcttgatttcgcctatgaatggtgtggggccagat
gacatcaaccttaaaagtttaattacccgtctaatggatggtaaggtgagcgaagttatc
gtagctaccaatgccacagcagatggggaagcaacgtccatgtatatttcacgtgtcttg
aaaccagccgggattaaggtaactcgtttggcaagaggtctcgcagtaggttcagatatt
gagtatgctgatgaagtaacattattgagagctattgagaatcgtactgaactttaa

DBGET integrated database retrieval system