KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: HCM1.259
Entry
HCM1.259          CDS       T00064                                 
Name
(RefSeq) hypothetical protein
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-GeneID: 1251264
NCBI-ProteinID: NP_569445
UniProt: A0A716BI66 Q9L5L2
Position
pHCM1:190873..191388
AA seq 171 aa
MFIPPVDDVKPIPVPVEIYTQCITDASRFFGIDAELVFTLFDNEGGKVGTFSRNKNGTYD
IGPMQINSSNLPEIRDHFPSVTWRVLAYDACASFWVGTWWLYRKIVDRKGNVFEGIADYN
SKTPKVRATYIFNFMIKYNRRIQRRNGMDELYQWTQPKPQYNGHIVKNLPE
NT seq 516 nt   +upstreamnt  +downstreamnt
gtgtttataccaccagtagacgatgtgaaacctattcccgttcctgttgagatctacacg
cagtgcattaccgatgcctcccgttttttcgggattgatgcggagttggtctttacgctt
tttgataatgagggcggaaaagtcgggacgttcagccgtaataaaaatggcacttatgat
attgggcctatgcagatcaattcgtccaacctgccagaaatacgcgaccattttccgtct
gttacgtggcgggtgctggcctatgacgcctgtgccagtttctgggtgggcacctggtgg
ctttaccggaagattgttgaccggaagggtaacgtatttgaagggattgccgattacaac
agcaaaacccctaaggtccgggcgacgtatatcttcaacttcatgatcaaatacaatcgc
cggattcagcgccgaaatggaatggacgaattatatcagtggacgcaacctaagccccag
tacaacgggcatattgtaaaaaatcttcctgaataa

DBGET integrated database retrieval system