KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: HCM1.264c
Entry
HCM1.264c         CDS       T00064                                 
Name
(RefSeq) pilus assembly protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Brite
KEGG Orthology (KO) [BR:sty00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sty02044]
    HCM1.264c
Secretion system [BR:sty02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HCM1.264c
SSDB
Motif
Pfam: TraF Thioredoxin_2 Thioredoxin_8 Thioredoxin
Other DBs
NCBI-GeneID: 1251260
NCBI-ProteinID: NP_569449
UniProt: A0A715CS90 Q9L5L6
Position
pHCM1:complement(197700..198746)
AA seq 348 aa
MTRLTLIPSKMLVLLSLFITGVHANEEQALIKDTPFVSGQAFKKGFFWYDDPTRKTEEEI
TETKPPVASSTQPEQEEKIELNSKWLKDNMPQLLTKAMDNPTPENLSRFYTAQRLMLDIG
TRFSDKSKDYFLKNPMMSEKRRQPVEKVALDAHRTVVEKNQQSVMKDIFTKSGLFFFFQS
TCQFCHEESQILQFMENYYSVDILPVSMDGRPLQNGLFQDFSVPNAQIIDQFKIREVPTI
FLVSKDGSSAQRISEGMITAEELKNTIILAAKGMKLIDDASFQSTLDIKRQYTIGEDGVI
TVNKSEMDSDPFLLQRIMDKKLEGYDMPTADPVNYLNVGGSLGGAYAR
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgactcgattaacgttaataccttcaaagatgttagtgctgctgtctttgtttattact
ggggtccatgcaaatgaagagcaggcccttatcaaagacactccctttgtatcaggacag
gccttcaagaaaggctttttctggtatgacgacccgacaaggaaaactgaggaagaaatt
acagagaccaagcctcctgttgcatcttcgacccagccagaacaagaagaaaagattgag
cttaattcaaagtggctaaaggacaatatgcctcagcttttgactaaggctatggataat
ccgacccctgaaaatttatcgagattttatacagcacaacgtttaatgctggatatcggt
acgcggttttcggataaatcgaaagattatttccttaaaaatccaatgatgtctgaaaaa
cgcaggcaaccggttgaaaaggtagcgctcgatgcacatcgtacggtggtcgagaaaaat
cagcagtcggttatgaaagatattttcactaaatccgggctgtttttctttttccagagt
acttgtcagttctgccacgaagaaagtcaaatactccagtttatggagaattactattct
gtcgacattcttcctgtcagcatggacggcagaccactacagaatgggttgttccaggat
ttctctgtacctaatgcgcagattattgatcaatttaaaatccgtgaagttccaactatt
ttccttgtctcaaaagatgggtcatcagcgcaacgaataagcgaaggcatgatcactgct
gaggagctcaagaatactattattctggctgcaaaaggcatgaagctgattgatgatgcc
tctttccagtccactttagatattaagcgccaatataccattggcgaggatggcgtaatt
actgtgaataaatcagaaatggactctgacccgttcttattgcaacgaataatggataag
aaactggaagggtacgatatgccaacggcggacccagtgaactatctgaatgtgggtgga
agtttaggaggtgcatatgcgcgctga

DBGET integrated database retrieval system