KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: HCM1.73Help
Entry
HCM1.73           CDS       T00064                                 

Gene name
trhB
Definition
(RefSeq) plasmid transfer protein
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Brite
KEGG Orthology (KO) [BR:sty00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sty02044]
    HCM1.73 (trhB)
Secretion system [BR:sty02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HCM1.73 (trhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI Pilin_N SNCAIP_SNCA_bd Utp11 DUF4699 Vma12
Motif
Other DBs
NCBI-GeneID: 1251202
NCBI-ProteinID: NP_569295
GeneDB: HCM1.73
UniProt: Q9L5U6
Position
pHCM1:47542..48900
Genome map
AA seq 452 aa AA seqDB search
MDIKKAWENKTVRISVIGAALMVLIVVISQSIFTTPVKKEKKTQKKDMQTGFLIDDSQMN
KLSNEESQKTYNEMVRQNRIDQNAAKADRDKAEKAQQENKAQIASLASQVQQLTTQLTEM
QTSRNGNRNLDAGGPRNNVNEQAPAKPYQLNPNAAVNGVSSGYAPISPTRNSPMRTITQS
SIKTNGTDGVIQVMPISENRIREGREVVAGSEKAPTRTIRGDGTAPVDSKARHAARKDEM
FLPATSIITGVLITGLEAPTSLSSKAEPMPVTMRIKKDIIMPNNYTMDLRDCNLLGSAVG
DLASQRAYIRATSISCVNSKGKAFDVIVEAYAVSENDGKNGIRGNLISRNGNAIAGSAFA
GGLSALAGSLSPSKVSSLNIDPNSTAQYQSPNIGALGALAGAGAAQGGLNRLVDYYTSIA
EQQWPIVEISPGRPITFVVQKGATIPTNLTSR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggacattaaaaaggcctgggaaaataaaactgtcagaatctcagtaattggtgctgca
ttgatggtattgattgttgtcatcagtcaatcaatctttaccacaccagttaaaaaagag
aagaaaacccagaaaaaagatatgcaaactggattccttattgatgattcacaaatgaac
aagctgagtaatgaggaaagccagaagacttataacgaaatggtaaggcagaaccgtatt
gaccagaacgctgccaaggctgaccgtgacaaagctgaaaaggctcagcaagaaaacaaa
gcacagatagccagtcttgcttcgcaagttcagcaactcactacgcagttgactgaaatg
cagacctcaagaaatggtaatcgcaatctcgatgcaggcggaccacgcaacaacgtcaat
gaacaagccccagcaaagccataccagcttaatccaaatgcagcggtgaacggggttagt
tctggatacgcacctatatctccgacccgaaacagtccaatgcggacaataacacagagt
tcaattaagacaaacggcactgatggtgtcattcaggtgatgccgatatcagagaaccgg
atcagagaggggcgcgaggttgttgcgggaagtgaaaaggccccaacgcgaactattcgc
ggcgatgggactgcacctgttgatagtaaagctcgtcatgcggcccgtaaggatgaaatg
tttcttccagcgacgtcaattattactggggtgctaattaccgggctggaagctccaacg
agtttgtcctctaaagcagaaccgatgccggttaccatgcgcattaaaaaagacatcatc
atgcctaacaattacacgatggatttgcgtgattgtaatttattgggttctgctgtgggg
gatctggcatctcagcgtgcgtacattagggcaacctccatatcgtgtgtcaactcgaaa
ggaaaagcattcgacgtaatagtggaagcttatgcggttagtgaaaatgacgggaaaaat
ggcattcgtgggaatctgataagcagaaatggaaatgcgattgcaggttctgcgtttgca
ggagggctgtcagcattggcggggagtctgagtccatcaaaggtgtcttcgcttaatata
gatccaaactctacggcacaataccaatcgccaaacataggtgcattaggagcgctggcc
ggagccggtgcagctcaggggggtctaaaccgtcttgtggactactatacgtcaatagct
gagcagcagtggccaattgtagaaattagcccagggcgcccaattacttttgtcgttcaa
aaaggggcgacaatacctacaaacctgacaagccgctga

DBGET integrated database retrieval system