KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0104Help
Entry
STY0104           CDS       T00064                                 

Gene name
apaG
Definition
(RefSeq) CorD protein
  KO
K06195  ApaG protein
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Brite
KEGG Orthology (KO) [BR:sty00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    STY0104 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-GeneID: 1246603
NCBI-ProteinID: NP_454701
GeneDB: STY0104
UniProt: Q8Z9J8
Position
complement(102087..102464)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGKGVVGVQPRIAPGEEYQYTGGAVIETPLGTMQGHYEMIDENGDAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgcccagagtgtgtattcaggtgcaaagcgtctacattgaggcgcaatcc
tcacctgacgatgaacgttacgtttttgcctataccgtaaccatccgcaatctgggtcgg
gcgccagtgcagctattgggccgctactggctgattaccaatggtcatggccgtgaaact
gaagtccagggcaaaggtgtggttggcgtccagccgcgcattgcgcctggcgaagagtat
cagtacaccggcggcgcggtaattgaaacgccgctgggcaccatgcagggtcattacgaa
atgatcgatgaaaatggcgacgcctttaccatcgacattcccgtgtttcgactcgccgtc
cctacactcattcactaa

DBGET integrated database retrieval system