KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0176Help
Entry
STY0176           CDS       T00064                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00010  Glycolysis / Gluconeogenesis
sty00020  Citrate cycle (TCA cycle)
sty00620  Pyruvate metabolism
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
sty01120  Microbial metabolism in diverse environments
sty01130  Biosynthesis of antibiotics
sty01200  Carbon metabolism
Module
sty_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STY0176 (aceF)
   00020 Citrate cycle (TCA cycle)
    STY0176 (aceF)
   00620 Pyruvate metabolism
    STY0176 (aceF)
Enzymes [BR:sty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STY0176 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H NQRA HlyD_D23 HlyD_3 DUF1223
Motif
Other DBs
NCBI-GeneID: 1246670
NCBI-ProteinID: NP_454767
GeneDB: STY0176
UniProt: Q8Z9E9
Position
182065..183954
Genome map
AA seq 629 aa AA seqDB search
MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAAAKDVHVPDIGSDEVEV
TEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVA
GEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVTEVMVKVGDKVTAEQSLIT
VEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAPA
AKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWV
MIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSL
SEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTAG
EMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSF
DHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcgggacagatgaagttgaaatcaccgagatt
ctggtcaaagtgggcgacaaagttgaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagatcaaagtctct
gtcggcgacaaaactgagaccggtgcacttatcatgattttcgattccgccgacggtgca
gctgacgctgcgcctgctcaggcagaagagaagaaagaagcggcgccggcagcagcacct
gctgcggcagcggcgaaagacgttcacgttccggatatcggcagtgacgaagttgaagtg
actgaagtgatggtgaaagtgggcgacaccgtagaagctgaacagtcgctgatcaccgtc
gaaggcgacaaggcctctatggaagttcctgctccgtttgcaggcaccgtgaaagagatc
aaagtgaacaccggtgataaagtgtctaccggctctctgattatggtcttcgaagtggcg
ggtgaagcgggcgcagcagcaccagcgaaagcggaagccgctccggctgcggctgctcca
gcagcagcgacgggcgtgaaagacgttaacgtaccggacatcggcggcgacgaagttgaa
gtcaccgaagtgatggtcaaagtcggcgataaagttaccgctgaacagtcgctgatcacc
gtggaaggcgacaaagcctctatggaagtgcctgcgccgttcgcgggcaccgtgaaagaa
atcaaaatcagcaccggcgataaagtgaaaaccggctcgctgattatggtcttcgaagtg
gaaggcgcagcgcctgcggccgctccggctaaacaggaagcagcggcgccggctccggcg
gcgaaagctgagaagcctgctgccccggctgccaaagccgaaggcaaatctgagttcgct
gaaaacgacgcttacgttcacgctaccccactgattcgccgtctggcgcgcgagtttggc
gtcaacctggcgaaagtgaaaggcactggtcgtaaaggccgtattctgcgcgaagacgtt
caggcttacgtgaaagacgctatcaaacgcgcggaagctgcgccggctgctgcgggcggc
ggtatcccgggtatgctgccgtggccgaaagtggacttcagcaagtttggtgaagttgaa
gaagtggaactgggccgtatccagaaaatctctggcgcgaacctgagccgtaactgggtg
atgatcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttccgt
aaacagcagaacgccgaagctgagaagcgcaaactggatgtgaaatacacgccagtggtc
ttcatcatgaaagcggttgccgctgctctggaacagatgccgcgcttcaacagctctcta
tccgaagacggtcagcgtctgaccctgaaaaaatacatcaacatcggcgtggcggttgat
accccgaatggcctggtggttccggtctttaaagacgtgaataagaagagcgtgaccgag
ctgtctcgtgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgaccgctggc
gaaatgcagggtggttgcttcactatctccagcatcggcggcctgggaactacccacttt
gcgccgattgtcaacgcgccggaagtggctatcctcggcgtttctaagtcggcgatggaa
ccggtgtggaatgggaaagagtttgtgccgcgtctgatgatgcctatctctctttctttc
gaccaccgtgtgatcgatggtgctgatggtgcgcgtttcattaccattatcaacaatatg
ttgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system