KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0288
Entry
STY0288           CDS       T00064                                 

Definition
(RefSeq) type VI secretion system protein
  KO
K11895  type VI secretion system protein ImpH
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Brite
KEGG Orthology (KO) [BR:sty00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sty02044]
    STY0288
Secretion system [BR:sty02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STY0288
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-GeneID: 1246778
NCBI-ProteinID: NP_454870
GeneDB: STY0288
UniProt: A0A715PHJ8 Q8Z979
Position
complement(303553..304548)
AA seq 331 aa
MTGALDQAQKAPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIA
QVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHYRWLTQF
WQAWRSGQSAGGGLDKPEHDRFAFYIASISGQDLRESAESPLSDHVRLAASAHLVRESRN
PDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQSSVLGNGALIGQAVPDMQY
KFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYCWEIELQLKPHAAPPAVIGGA
QRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaccggcgctctcgaccaggcgcagaaagccccctggcgttacggattcctgaacctg
atgcgacgcgtggatgcccagctctgtgatactccggcaggcagtatctggcagcctcgg
atggaaaaattccgtctgggacagacgccgacgatgacctttgcaccacgggaaatcgcc
caggtcagctggcaggatggacgcctgcacctgagcctgtacagcctcggactatggggg
ccaaacggcccgttgccgctgcactataccgagctggcgctaaatcgctcagagagtcgt
cacgatccgacgctggttcatttttccaatatttttcactaccgctggctgacgcagttc
tggcaggcatggcgcagcggccagtccgctggtggcgggctggacaaaccggaacacgac
cgttttgcgttttatatcgccagtatcagcgggcaggatctacgggaaagcgccgaaagc
ccgctgtcagatcatgttcgcctggcggcctccgcccatctggtacgcgagtcgcgcaat
cctgacgggctggccgccacgctggcgcactatttcagcgtaccttttgcggtgaaagag
tttgccctgcactggataacggtggcgaacgatgaaatcacccgtctgggcacgcccgcg
cagtcttcggtgctgggcaacggggcgcttatcggccaggccgtaccggatatgcagtac
aaattccggctaattatcggcccgctcacgctggaggattacctgcgttttctgcccggc
ggcaacaatctgcccgtgctgacagaactggtgcgtacgttcatcggttttgaatattgc
tgggaaattgagctgcagttgaagccccatgccgcaccgcctgcggtgatcggcggcgcg
cagcggcttggctggacggcctgggcaggtaaagccatgcatgaccgtccggtgaccggc
atgatttttgaacctgaacacggcttaacccactga

DBGET integrated database retrieval system