KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0290
Entry
STY0290           CDS       T00064                                 

Definition
(RefSeq) type VI system protein
  KO
K11897  type VI secretion system protein ImpF
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Brite
KEGG Orthology (KO) [BR:sty00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sty02044]
    STY0290
Secretion system [BR:sty02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STY0290
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-GeneID: 1246780
NCBI-ProteinID: NP_454872
GeneDB: STY0290
UniProt: A0A714JLY6 Q8Z977
Position
complement(306444..306938)
AA seq 164 aa
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGD
IDARRYPQAAASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLL
DEARQGSYNTLQFEIRGQILTQPYPTEFLVRSALDMELSRITFF
NT seq 495 nt   +upstreamnt  +downstreamnt
atgagcacgtctcgttttacacccgctaaccacctgctgcctacgctgtttgatcggctg
tgtgacaatgctccgtatcagaaaattgaccgggatatcagcgtcacgccggtacaactg
aaggagatcattcgtcgggatctctcctttttgctcaataccattagccacgagggtgac
atcgacgcccggcgctatccgcaggcggcggcgtcagtgctcaactatggcctgccgccg
ctggcgggcagctttatgtatgagcacaagtgggacgatatcagcgaggcgatccggcgc
gccattatccgtttcgaaccccggctgaacgccgccacactcagggtcacgcccttgctc
gatgaagcccggcagggtagctataacacgctacagtttgaaattcgcggacaaattctg
acgcagccgtatcccacggagtttctggtacgcagcgcgctggatatggagctgagccgc
attacgttcttttaa

DBGET integrated database retrieval system