KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0302
Entry
STY0302           CDS       T00064                                 

Definition
(RefSeq) type VI secretion protein HCP
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sty00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STY0302
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sty02044]
    STY0302
Secretion system [BR:sty02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STY0302
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 1246791
NCBI-ProteinID: NP_454882
GeneDB: STY0302
UniProt: Q93IS5
Structure
PDB: 
5XHH

Position
315281..315766
AA seq 161 aa
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDH
YIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIA
SRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcttatgacatttttttaaaaattgacggcattgatggcgagtcaatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatattcatcaggaatccaccatg
cacgccggtagcggcctcggctccggtaaggtctccgtcactaatctggattttgatcac
tatatcgatcgcgccagcccgaacctgttcaaatactgcgcctccggcaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtatacc
ttcaccgacctgattgtcgccgtggtttccccgagcggcagccacgatggtgaaatcgcc
tcccgtgaaacggtcgagctttctttcagcactgtgaaacaggaatacgtggtgcagaac
cagcagggcggcagcggcggcactatcaccgcaggttacgacttcaaggcgaacaaagaa
atttaa

DBGET integrated database retrieval system