KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0303Help
Entry
STY0303           CDS       T00064                                 

Definition
(RefSeq) lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sty00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STY0303
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sty02044]
    STY0303
Secretion system [BR:sty02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STY0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-GeneID: 1246792
NCBI-ProteinID: NP_454883
GeneDB: STY0303
UniProt: Q8Z967
Position
315833..316369
Genome map
AA seq 178 aa AA seqDB search
MNEWRNPTRWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAP
IEIRVYELKNDAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTA
IGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIPGKGKVQLEAELEQSAIVITERDK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaatggcgtaaccccactcggtggttatgtgcggtagctatgccttttgcactg
ctcctgctttccggatgcggcagtagcgatgcgttacctgacctcgaatcacagcgactc
gacctgagcgtgaaagcctccgataaggtgaatcctgacaatcagaagaaggccgcgccc
attgagatacgtgtttatgaactaaaaaatgacgccgctttcacgacagctgattactgg
tcgctccatgacaacgacaaatccgtccttaccgacgatttagtgcgtcgcgacagcttt
attttgcgtcccggcgaagagaaaaaactgcgtcgcccgctgaatgcgcagaccacggca
atcggcgtactggccggataccgtaacctggccaaatcggtctggcgggtaacctacaaa
atcccggaagccccggaaaaagcctggtacagcagcttcataccggggaaaggaaaagtg
cagttggaggcggaactggaacaaagcgccattgtaattacggaacgggataaatga

DBGET integrated database retrieval system