KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0319
Entry
STY0319           CDS       T00064                                 

Definition
(RefSeq) Rhs-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sty00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STY0319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sty02044]
    STY0319
Secretion system [BR:sty02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STY0319
SSDB
Motif
Pfam: Phage_GPD Phage_base_V T3SSipB
Other DBs
NCBI-GeneID: 1246806
NCBI-ProteinID: NP_454896
GeneDB: STY0319
UniProt: A0A715LMA1 Q8Z954
Position
328636..330825
AA seq 729 aa
MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAEAAVEQAAGSLFGALPEP
SGLVKAAVAAAQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGG
ETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTA
ARVVGHEGRSVTYELRMEPWVKLLTHTSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVES
YPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLVLADAISAHKACPDSPLVEW
HQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRETGHATYEHYEW
PGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQE
IWTDQYGRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGD
PDLPIIVGRTYNQDTMPPWGLPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHA
EKDLNTTVKNNETHTVMVDRTKTIIKNETNSIGEDRNTTVTKNDGLSVKLAQTINIGTTY
RLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVMQLIGKGIDMNPDGGTAVTAD
DIAPLPTSE
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgagttttgtatccacaaataataaatccggtatgggagggctgacgacaaccacgccg
ccgataaccggagaaagtggcggtgtcaccgcagattcagtcgccggaagcgtggcagat
gcggcagaagccgccgtggaacaggctgcgggatcgctgtttggcgcattgccggagcca
tcaggactggtgaaagccgcggtggcagcggcgcaggctgccgccgctgcaggtatggcg
caggatgcggtatcggccatcgtctctgctgttgcaggcgggccgggggcgcataatgtg
acggtcagcggcagcgccgtaccgccgggcgcattactgttcgccagcctggacggcggc
gaaacattaagtgaactgttcagttatgtggtacagctaaaaacgcccgacaccctgaat
ctgggctatgtctccccggcggccaacctgccgctcaaaccgatggtgggcaaagatctg
tgcgtcaacatcgaactggatggtggcggtaaacgacatatcagcgggctggtcacggcg
gcgcgggtggtgggccatgaagggcgttcggttacctatgagctgcgtatggagccgtgg
gtaaaactgctgacccataccagcgactacaaagcattccagaataaaaccgtggtggat
attctggatgaggttctggcggaatacccctacccggtggaaaagcggctggtggaaagc
tacccggtacgcacctggcaggtgcagtacggtgaaactgattttgattttcttcagcga
ctgatgcaggagtggggcatctactggtggtttgagcacagcgaggacagccacacgctg
gtgctggcggatgccatcagcgcccacaaagcatgtccggactcgccgctggtcgagtgg
caccaggaagggctgaagctggacaaggagtttatccacactatcacggcaaacgagagt
ctgcggactggccagtgggtgctggatgatttcgattttacgaagccacgttcattgctg
gcaaacaccgtggcaaacccgcgtgaaaccggtcatgccacctacgagcattatgagtgg
ccgggagactacttcgacaagagtgaaggcgagatgctgacgcgcattcgtatggaagcg
cagcgcagccccggcagtcgggtgctggggggagggaatatccgcacactcatgaccggt
tataccttcacgctggaaaactatcccaccgccgaagtcaatcaggaatacctgctgatg
cagaccttgctgtttgtacaggacaacgcgcagcacagcgggcaggaccagcactttacc
ttttccacccgttttgaactgcacccgacccgtgaggtgttccgcccgcagcggacggtg
agcaaaccccacaccaaagggccgcagagcgccatcgtcaccggcccggcgggccaggaa
atctggacggatcagtacgggcgggtaaaggtacagtttggctgggatcgctacggcaaa
atggatgaaaacagctcctgctggatacgcgtcagctacccatgggcgggcaaaggcttc
gggatgatccagatcccgcgtatcggccaggaagtgctggtggatttcaaaaacggcgat
ccggatctgccgatcatcgtggggcgtacctacaaccaggacaccatgccgccgtgggga
ctgccgggaatggcgtcgcagagcgggatcttcagccactcgctgtatggcgggccaacg
aacggcaacatgctgcgttttgacgacaaaacgggcgcggaggaagtgaagttccacgcg
gaaaaagatctcaacaccacggtgaagaataatgaaacgcatacggttatggtggatcgc
actaaaaccattattaaaaatgaaaccaacagtattggtgaagacagaaacaccacggta
acgaagaatgacggcctttccgtaaaactggcgcagacgatcaatatcggcaccacttat
cgtttagatgttggcgatcaattcacacttcgctgcggcaatgcggcgcttgttttacat
aaggacggctccattgagttttgtggcaagcaactgatgttgcataccagcgatgtcatg
caactgattggtaaaggtattgatatgaacccggatggcggcacagccgtaaccgccgat
gatattgccccccttcccacctctgagtga

DBGET integrated database retrieval system