KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY0571Help
Entry
STY0571           CDS       T00064                                 

Gene name
allB
Definition
(RefSeq) allantoinase
  KO
K01466  allantoinase [EC:3.5.2.5]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00230  Purine metabolism
sty01100  Metabolic pathways
sty01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STY0571 (allB)
Enzymes [BR:sty01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.5  allantoinase
     STY0571 (allB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 DHOase zinc_ribbon_4 C1_4
Motif
Other DBs
NCBI-GeneID: 1247039
NCBI-ProteinID: NP_455115
GeneDB: STY0571
UniProt: Q8XGS6
Position
577181..578542
Genome map
AA seq 453 aa AA seqDB search
MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLDATGLIVSPGMVDAHT
HISEPGRTHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAKGKLTIDA
AQLGGLVSYNLDRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFYKGAQKLGEMD
QTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKAAGCRLHV
CHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGM
WEKLFNGEIDCLVSDHSPCPPEMKAGNIMQAWGGIAGLQNCMDVMFDEAVQKRGMSLPMF
GKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDSSYVLKNEDLEYRHKVSPYVGRTIGA
RITKTILRGDVIYDIEHGFPVPPKGQFILKHQQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgatttaattattaagaacggtactgtcatcttagaaaacgaagcgagagtt
atcgatatcgccgtccagggcggaaaaatcgccgcgattggcgagaacctgggggaagcg
aaaaacgtgctggatgcgacgggattgatcgtttcgccgggcatggttgacgcgcatacc
cacatttctgaaccgggccgtacccactgggaaggctatgaaaccggtacgcgcgcggcg
gcgaaaggcggtattaccacgatgattgagatgccgctcaatcagctgccggcgacggtc
gatcgtgagacgattgaactcaagtttgacgcggcaaaaggtaaattgaccatcgacgcc
gcgcagttgggcggtttggtctcttataacctggatcggctgcatgagctggacgaagtg
ggcgttgtcggcttcaagtgctttgtcgccacctgcggcgatcgtggcatcgataatgat
tttcgcgacgttaatgactggcagttttacaaaggcgcgcaaaaactgggagagatggac
cagacggtactggtacattgcgaaaatgctctgatttgcgatgagctgggcgaagaagct
aaacgcgaaggtcgcgtaacggcgcatgattatgtcgcctcacgtccggtatttactgaa
gtggaagccattcgtcgcgtgctgtatctggcgaaagcggcaggttgccgtctgcacgtt
tgtcatatcagcagcccggagggggtagaggaagtaacgcgtgcgcgtcaggaaggccag
gatgtcacctgtgaatcgtgcccgcactattttgtcctcgataccgatcagttcgaagag
attggcaccctggcaaaatgttctccgccaattcgcgaccaggaaaaccagaaagggatg
tgggaaaaactgtttaacggcgaaatcgactgcctggtatccgaccactctccatgtcct
ccggaaatgaaagcaggcaatatcatgcaagcatggggtggaattgccggactgcaaaac
tgcatggacgtcatgtttgatgaagcggtgcaaaaacgcggtatgtcgttgccgatgttt
ggcaaattaatggcgaccaacgccgccgatatttttggtctgaaacataaaggacgtatt
gcccccggcaaagatgctgacctggtctttattcagcctgacagcagctatgttctgaaa
aatgaagatctggaatatcgccataaagtcagtccgtatgttggccgtactattggcgcg
cgtattaccaaaacgattttgcgcggcgatgttatttatgacatcgagcatggcttccct
gtgccgccaaaaggtcagtttatccttaaacatcagcagtaa

DBGET integrated database retrieval system