KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY1682Help
Entry
STY1682           CDS       T00064                                 

Gene name
sodC
Definition
(RefSeq) copper-zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Brite
Enzymes [BR:sty01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STY1682 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 1248056
NCBI-ProteinID: NP_456090
GeneDB: STY1682
UniProt: Q8Z6P6
Structure
PDB: 

Position
complement(1610160..1610681)
Genome map
AA seq 173 aa AA seqDB search
MKRLSLAMVTLLACAGAQAASEKVEMNLVTAQGVGQSIGTVVIDETEGGLKFTPHLKALP
PGEHGFHIHAKGSCQPAIKDGKAVAAEAAGGHLDPQNTGKHEGPEGQGHLGDLPVLVVNN
DGIATEPVTAPRLKSLDEVKDKALMIHVGGDNMSDQPKPLGGGGTRYACGVIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattaagtttagcgatggtgacgctgctggcctgtgcgggtgcgcaggctgcc
agcgagaaagtagagatgaatctggtgacggcgcaaggcgtaggacagtctatcggcacc
gtcgtcatcgatgaaaccgaaggcggcttaaaatttaccccacaccttaaagcgttgccg
ccgggcgagcatggttttcacattcatgccaaaggtagctgccagcccgcgattaaagac
ggcaaagcggttgccgcagaagccgctggtggtcatctggacccacaaaataccggtaag
catgaaggaccggaaggtcaggggcatctgggcgacctcccggtgttagtcgttaataat
gatggtatcgccaccgaaccggttactgcgccgcgtctgaagtctcttgatgaagtgaaa
gataaagcgctcatgatccatgtgggcggcgataacatgtccgatcagccgaaaccgctc
ggcggcggcggaacgcgttacgcctgcggcgtcattaaataa

DBGET integrated database retrieval system