KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2304Help
Entry
STY2304           CDS       T00064                                 

Gene name
rfbC
Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00521  Streptomycin biosynthesis
sty00523  Polyketide sugar unit biosynthesis
sty01130  Biosynthesis of antibiotics
Module
sty_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    STY2304 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STY2304 (rfbC)
Enzymes [BR:sty01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     STY2304 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom HpuA
Motif
Other DBs
NCBI-GeneID: 1248639
NCBI-ProteinID: NP_456643
GeneDB: STY2304
UniProt: Q8Z5I2
Structure
PDB: 

Position
complement(2133107..2133658)
Genome map
AA seq 183 aa AA seqDB search
MMIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKSKKNVLR
GLHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAH
GFVTLSDYAEFLYKATNYYSPSSEGSILWNDETIGIEWPFSQLPELSAKDAAAPLLHQAL
LTE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgatgattgtgattaaaacagcaataccagatgtcttgatcttagagcctaaagttttt
ggcgatgagaggggattcttttttgaaagttataaccagcagacctttgaagagtcgatt
ggacgtaaagttacatttgttcaagataatcattcaaaatccaaaaagaatgtactcaga
gggctacattttcagagaggagaaaatgcacagggaaagttagttcgctgtgctgtcggt
gaggtttttgatgttgcggtcgatatccgaaaagaatcacctacttttggtcagtgggtt
ggcgtaaatctatctgctgagaataagcgacagctttggattccagaaggttttgctcat
ggttttgttactctcagtgattatgcagagtttctgtacaaagcaactaattattactca
ccttcatcggaaggtagcattctatggaatgatgagacaataggtattgaatggcctttt
tctcagctgcctgagctttcagcaaaagatgctgcagcacctttactgcatcaagccttg
ttaacagagtaa

DBGET integrated database retrieval system