KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2308Help
Entry
STY2308           CDS       T00064                                 

Gene name
galF
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00040  Pentose and glucuronate interconversions
sty00052  Galactose metabolism
sty00500  Starch and sucrose metabolism
sty00520  Amino sugar and nucleotide sugar metabolism
sty01100  Metabolic pathways
sty01130  Biosynthesis of antibiotics
Module
sty_M00362  Nucleotide sugar biosynthesis, prokaryotes
sty_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STY2308 (galF)
   00052 Galactose metabolism
    STY2308 (galF)
   00500 Starch and sucrose metabolism
    STY2308 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    STY2308 (galF)
Enzymes [BR:sty01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     STY2308 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 EFP_N
Motif
Other DBs
NCBI-GeneID: 1248643
NCBI-ProteinID: NP_456647
GeneDB: STY2308
UniProt: P0A2K8
Position
complement(2136946..2137839)
Genome map
AA seq 297 aa AA seqDB search
MMNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDDATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttgaaagcagttataccggtagcgggtttgggtatgcatatgttgcctgcc
accaaggcaatcccaaaagagatgctaccgatcgtcgacaaaccgatgattcagtacatt
gtcgatgagattgtggctgcagggatcaaagaaatcgtgctggtgactcacgcgtctaaa
aatgccgttgagaaccacttcgacacctcttatgaacttgaatcgcttcttgagcagcgc
gttaagcgtcagcttctggcggaagtgcaatctatctgcccaccgggcgtgacgattatg
aacgttcgccaggcgcagccgttaggactggggcactctattctgtgcgcgcgtccggtt
gtgggcgataaccctttcattgtggtactcccggatattattattgatgatgctaccgcc
gatccgctgcgctataaccttgcggcgatggtggcgcgtttcaatgaaacgggtcgcagc
caggtgctggcaaagcgcatgaaaggtgatttatcggagtattccgttatccagacgaaa
gaacctctggataatgaaggcaaagtcagccggattgtggagtttatcgaaaaaccggat
cagccgcagacgctggattccgatttgatggcggtaggccgttatgtgctttcagccgac
atctgggcggaactggaaagaaccgaaccgggcgcctggggccgcatccagcttaccgat
gcgattgctgaactggcgaaaaaacagtcggttgacgcgatgctaatgacgggcgacagc
tatgactgcggtaaaaaaatgggctacatgcaggcatttgtgaagtacgggctgcgcaac
ctgaaagaaggagcgaagttccgtaagagcatagagcagcttctgcatgaataa

DBGET integrated database retrieval system