KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2601Help
Entry
STY2601           CDS       T00064                                 

Gene name
pdxB
Definition
(RefSeq) erythronate-4-phosphate dehydrogenase
  KO
K03473  erythronate-4-phosphate dehydrogenase [EC:1.1.1.290]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00750  Vitamin B6 metabolism
sty01100  Metabolic pathways
Module
sty_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STY2601 (pdxB)
Enzymes [BR:sty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.290  4-phosphoerythronate dehydrogenase
     STY2601 (pdxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C DUF3410 2-Hacid_dh
Motif
Other DBs
NCBI-GeneID: 1248925
NCBI-ProteinID: NP_456912
GeneDB: STY2601
UniProt: P60801
Structure
PDB: 

Position
complement(2437375..2438511)
Genome map
AA seq 378 aa AA seqDB search
MKILVDENMPYARELFSRLGEVKAVPGRPIPVEELNHADALMVRSVTKVNESLLSGTPIN
FVGTATAGTDHVDEAWLKQAGIGFSAAPGCNAIAVVEYVFSALLMLAERDGFSLRDRTIG
IVGVGNVGSRLQTRLEALGIRTLLCDPPRAARGDEGDFRTLDELVQEADVLTFHTPLYKD
GPYKTLHLADETLIRRLKPGAILINACRGPVVDNAALLARLNAGQPLSVVLDVWEGEPDL
NVALLEAVDIGTSHIAGYTLEGKARGTTQVFEAYSAFIGREQRVALETLLPAPEFGRITL
HGPLDQPTLKRLAHLVYDVRRDDAPLRKVAGIPGEFDKLRKNYLERREWSSLYVMCDDET
AAALLCKLGFNAVHHPAH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattctcgttgatgaaaatatgccttacgcccgcgaattatttagccgcctgggt
gaggtaaaggcagtgccgggtcgcccgatccccgttgaagaattgaaccatgccgatgcg
ttaatggtgcgttcggtcacgaaagtgaatgaatcgctgctgagcggcacgccgattaac
ttcgttggtactgctacggcaggcaccgatcatgtggatgaggcatggctgaagcaggcg
ggcatcggtttttcagccgcgcccggctgtaatgctatcgccgtggtggagtatgtgttt
tccgcgctgttgatgctggccgaacgtgacggcttttcgttacgcgatcgcactataggg
attgtcggcgtgggtaacgtcggaagccggctacagaccaggcttgaagcgttgggtatc
cgcacgttgctgtgcgatccgccacgcgccgcacgcggagacgagggtgattttcgtacg
ctggatgagctggtgcaggaagcggatgtcctgactttccatacgccgctctataaagac
ggaccgtacaaaacgctgcatctggccgatgagacgctgatccgtcgactgaaacccggc
gccattctcattaacgcctgccgcggcccggtggtggataacgccgcattgctggcgcga
ctcaatgccgggcagccgctgagcgtggtgcttgatgtgtgggagggcgaaccggatctt
aacgtcgcgctactggaagccgtggatatcggcacgtcgcatattgccggctatacgctg
gaaggcaaagcgcgcggcaccacccaggtctttgaggcgtatagcgcgtttatcggtcgc
gagcagcgtgtcgcgctggagacattactgcctgcgcctgagtttggtcgtattacgctt
cacggcccgctggatcaaccgacgctgaaaagactggcgcatttggtgtatgatgtgcgc
cgcgacgatgcgccactgcgtaaagtcgctggaattccgggtgaatttgataaattgcgt
aaaaattatcttgagcgccgtgaatggtcgtctttatacgtgatgtgtgacgacgaaacg
gcagccgccttgctgtgtaagctaggttttaacgctgttcatcacccggcacattaa

DBGET integrated database retrieval system