KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2621Help
Entry
STY2621           CDS       T00064                                 

Definition
(RefSeq) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00071  Fatty acid degradation
sty00280  Valine, leucine and isoleucine degradation
sty00281  Geraniol degradation
sty00362  Benzoate degradation
sty00592  alpha-Linolenic acid metabolism
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
sty01120  Microbial metabolism in diverse environments
sty01130  Biosynthesis of antibiotics
sty01212  Fatty acid metabolism
Module
sty_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STY2621
   00592 alpha-Linolenic acid metabolism
    STY2621
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STY2621
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    STY2621
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STY2621
   00642 Ethylbenzene degradation
    STY2621
Enzymes [BR:sty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     STY2621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 1248944
NCBI-ProteinID: NP_456930
GeneDB: STY2621
UniProt: Q8Z4Y9
Position
complement(2455221..2456531)
Genome map
AA seq 436 aa AA seqDB search
MRQALPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVVGELLARSEIPADAIE
QLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQAVANVAESLMAGTIRA
GIAGGADSSSVLPIGVSKALARVLVDVNKARTTRQRLTLFSRLRLRDLLPVPPAVAEYST
GLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWAEGKLAEEVMTTYVPPYKNPFAE
DNNIRGASTLADYAKLRPAFDRKHGSVTAANSTPLTDGAAAVILMTESRAKELGLRPLGY
LRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMADLTLFDMHEAFAAQTLANLQLLGSE
RFAREVFGRAQATGEVDDAKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT
ACAAGGLGAAMVLEAE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaggctttaccgttggtcacccgtcagggcgatcgcattgctattgtcagtggg
ttacgaacccccttcgctcgtcaggccactgcatttcatggtattcccgctgttgatctc
ggcaagatggtggtaggcgagctgctggcgcgcagtgaaattccagccgatgccattgag
caactggtttttggtcaggtagtacaaatgccggaagcccccaatattgcgcgcgaaatt
gtgctgggtacgggaatgaatgttcataccgatgcctatagcgtaagccgcgcctgcgcc
accagttttcaggcggtagcgaatgtggcggaaagcctgatggccggcacgatacgcgcg
ggtatcgctggcggcgcagattcgtcgtcggtactgccaataggcgtgagtaaagccctg
gcgcgggtactggttgatgtcaataaagcccggacgacccgccaacggctgacgcttttt
tctcgtctgcgcttacgcgacctgctgcccgttcctcccgccgttgctgagtattccacc
ggtctgcgcatgggcgataccgccgaacagatggcgaaaacgtatggtattacgcgtgaa
cagcaggacgcgctggcgcatcgttcacatcagcgcgccgcgcaggcatgggcggagggt
aaactggcggaagaagtgatgacgacctatgtgccgccgtataaaaacccctttgcagaa
gacaacaacattcgcggtgcctccacgctggcggactacgctaaactgcgtcccgctttt
gaccgaaaacatggctccgtaaccgccgccaacagtacaccgctgaccgacggcgctgcc
gccgttattctgatgaccgaatcccgcgctaaagagctggggctgcgcccgcttggttat
ctgcgcagctacgcctttaccgctattgatgtctggcaggacatgctattggggccggcc
tggtcaacgccgctggcgctggagcgggccgggttgacgatggccgatctgacgcttttt
gacatgcatgaagcgtttgccgctcagactctggcgaacttacaactgctgggcagcgaa
cgatttgcccgtgaggtgtttggtcgtgcgcaggcgacaggggaggtggatgacgctaaa
ttcaacgtgctcggcggctcaatcgcctacgggcatccttttgccgcaacgggcgcgcgg
atgataacccaaacgttgcatgaattacggcgtcggggcggaggttttggcctggtcacg
gcctgcgcggctggcggtcttggcgcggcgatggttctggaggcggaataa

DBGET integrated database retrieval system