KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2721Help
Entry
STY2721           CDS       T00064                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00300  Lysine biosynthesis
sty01100  Metabolic pathways
sty01120  Microbial metabolism in diverse environments
sty01230  Biosynthesis of amino acids
Module
sty_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STY2721 (dapE)
Enzymes [BR:sty01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     STY2721 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-GeneID: 1249036
NCBI-ProteinID: NP_457017
GeneDB: STY2721
UniProt: Q8Z4S2
Position
2558007..2559134
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDVGCQALMIERLRKIGFTIEHMDFGDTQNFWAWRGRGET
LAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPH
HRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacagcaacttattcgtcgcccctccctgagtccg
gatgacgtaggctgtcaggcattaatgattgaacgcctgcgtaaaatcggttttaccatt
gagcatatggattttggcgacacgcaaaatttttgggcatggcgtgggcgtggcgaaacg
ctggcgttcgccgggcatactgacgtcgtaccggctggcgatgtcgatcgctggatcaat
ccgccgtttgaacctacgattcgcgacggaatgttgttcggtcgcggcgcggcggatatg
aaaggttcactggcggccatggtggtggctgctgaacgttttgttgcacagcatcctcat
caccggggccgcctcgcatttttgattacctctgatgaagaagccagcgcaaaaaatggc
accgtaaaggtggttgaagcgctgatggcccgtaacgagcggctggattactgtctggtc
ggcgaaccttccagtactgaaattgtgggcgatgtcgtcaaaaacgggcgtcgcggttcc
ctcacctgtaacctcactattcatggcgttcaggggcacgttgcctatccgcatctggcg
gataaccctgttcatcgcgccgcgccttttctcaatgaactggtcgctatcgagtgggat
cggggcaatgactttttcccggccaccagtatgcagatagccaatatccaggcaggcacc
ggcagcaataatgtcattcccggcgaactgttcgtgcagtttaacttccgttttagcacg
gagctgaccgatgagatgatcaaagaacgggtacatgcgctgcttgagaagcatcagcta
cgctataccgtagactggtggctttccggtcagccgttcctgaccgcacgcggaaagctg
gtggacgcggtggtaaacgccattgagcactataatgaaattaaaccgcaattactgacg
acgggcggtacgtccgacggacgttttatcgcccgtatgggagcgcaggtggtagaactg
gggccggtgaacgccaccattcataaaattaacgaatgtgtgaatgccgccgatctccag
ctactggcccgtatgtatcaacgtattatggaacagctcgtcgcctga

DBGET integrated database retrieval system