KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY2983
Entry
STY2983           CDS       T00064                                 

Gene name
sitA
Definition
(RefSeq) iron transporter substrate-binding protein
  KO
K11604  manganese/iron transport system substrate-binding protein
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sty00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STY2983 (sitA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sty02000]
    STY2983 (sitA)
Transporters [BR:sty02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/iron transporter
    STY2983 (sitA)
SSDB
Motif
Pfam: ZnuA
Other DBs
NCBI-GeneID: 1249290
NCBI-ProteinID: NP_457255
GeneDB: STY2983
UniProt: Q9XCS2
Structure
PDB: 
5JG7

Position
2859262..2860179
AA seq 305 aa
MTNLHRLKTLLIAGIVAILALSPAYAKEKFKVITTFTVIADMAKNVAGDAAEVSSITKPG
AEIHEYQPTPGDIKRAQGAQLILANGLNLERWFARFYQHLSGVPEVVVSTGVKPMGITEG
PYNGKPNPHAWMSAENALIYVDNIRDALVKYDPDNAQIYKQNAERYKAKIRQMADPLRAE
LEKIPADQRWLVTSEGAFSYLARDNDMKELYLWPINADQQGTPKQVRKVIDTIKKHHIPA
IFSESTVSDKPARQVARESGAHYGGVLYVDSLSAADGPVPTYLDLLRVTTETIVNGINDG
LRSQQ
NT seq 918 nt   +upstreamnt  +downstreamnt
atgacgaatctacatcgtctaaaaacactcctgattgccggtattgtcgcgatactcgcg
ctatcgccagcctatgcaaaagagaaatttaaagtcatcaccacgtttaccgttattgcc
gacatggcgaaaaacgtggcgggcgacgcagcggaagtcagctcgattaccaagcccggc
gctgaaatccatgagtatcagccaacgcccggcgatattaaacgagcgcagggggcacag
cttatcctcgcgaatggtctgaacctggagcgatggttcgcccgcttttatcagcacctt
tccggtgtaccggaagtcgtcgtctccaccggcgtcaaaccgatgggcattaccgaaggc
ccgtataacggtaaaccgaacccgcacgcctggatgtcggcagaaaacgcgctgatttat
gtcgataacattcgcgacgccctggtgaagtacgatccggataatgcgcagatctataag
caaaatgccgaacgctataaagcgaaaattcgccagatggccgatccgttgcgtgccgag
ctggaaaaaattcccgccgatcagcgctggctggtcaccagtgaaggcgcgttctcttac
ctggcgcgcgataacgacatgaaagagctttatctctggccaattaacgccgatcaacag
gggacgccaaaacaggtgcgtaaagtgattgataccattaaaaagcaccatattcccgcc
atctttagcgagagtacggtttccgataaacccgcccgccaggtcgcgcgtgaatccggc
gcgcattatggcggcgtactgtatgtcgattctctgagcgccgctgacggccctgtgcca
acctatctggatctgctgcgcgtcacgaccgaaaccatcgtcaacggcattaacgacgga
ctgaggagtcaacaatga

DBGET integrated database retrieval system