KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3052Help
Entry
STY3052           CDS       T00064                                 

Gene name
surE
Definition
(RefSeq) 5'/3'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00230  Purine metabolism
sty00240  Pyrimidine metabolism
sty00760  Nicotinate and nicotinamide metabolism
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STY3052 (surE)
   00240 Pyrimidine metabolism
    STY3052 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    STY3052 (surE)
Enzymes [BR:sty01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     STY3052 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-GeneID: 1249355
NCBI-ProteinID: NP_457316
GeneDB: STY3052
UniProt: P66882
Structure
PDB: 

Position
complement(2918049..2918810)
Genome map
AA seq 253 aa AA seqDB search
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFDNGD
IAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLNGYQHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDLPLAQVKGIRVTRCGSRH
PADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLTAHSAHDVV
SDWLDSVGVGTQW
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatattgctgagtaacgatgacggggttcacgcgcccggtatacaaacgctggcg
aaagcgctgcgtgagtttgctgatgtacaggtcgtagccccggatcgtaaccgcagcggc
gcgtctaattccctcacgctggaatcttcgcttcgtacttttacctttgataatggcgat
atcgctgtacagatggggacgccgaccgattgcgtctatctgggcgttaatgccttaatg
cgtccgcgtccggatattgtcgtttccggtattaacgcgggtccgaatctgggcgatgat
gtgatctattccggtactgtcgccgcggcgatggaaggtcgtcatctcggctttccggca
ttagcggtctcccttaacggctatcagcattatgatacggctgcagccgtgacttgcgcg
cttttgcgagggttaagccgggagccgttgcgtaccgggcgtattctcaacgtgaatgtc
ccggatctaccgttagcgcaggttaaaggcatccgcgtgactcgctgcggtagccgccat
ccagcggataaagtgatcccgcaggaagatccacgcggtaatacattgtactggattggc
ccgccgggtgataaatacgatgccgggccggataccgatttcgcggcggtggatgaaggc
tacgtctccgtcacgccgttgcatgtggatttaaccgcgcacagcgcgcatgatgtggtt
tcagactggttagacagcgtgggagttggcacgcaatggtaa

DBGET integrated database retrieval system