KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3113Help
Entry
STY3113           CDS       T00064                                 

Gene name
fucA
Definition
(RefSeq) fuculose-1-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00051  Fructose and mannose metabolism
sty01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    STY3113 (fucA)
Enzymes [BR:sty01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     STY3113 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 1249410
NCBI-ProteinID: NP_457369
GeneDB: STY3113
UniProt: Q8Z431
Position
complement(2981207..2981854)
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTESHIVFIDA
DGQHEQGKLPSSEWRFHMAAYQTRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSDHVAVALKNRKATLLQHHGLIACEENLDKALWLAHEVEVLAQL
YLSTLAIVDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaatagactggctcggcagattattgatacctgtctggaaatgacgcggtta
gggttaaatcaggggacggcaggtaacgtgagcgtacgttatcagggcggaatgctgatt
acgccgacggggatcccctacgagaagctgacagagtcgcacattgtctttattgatgca
gacggtcagcatgagcagggcaagctgccttccagcgagtggcgttttcatatggcggca
taccagacgcgccctgacgccaatgccgtggtacataaccacgctgtccattgtacggca
gtctcgatcctgaatcgcccgattccggcgattcactacatgattgccgccgcggggggg
aactctattccctgcgcgccctacgccacttttggcacccgcgaactttctgaccatgtt
gccgtggcgcttaaaaatcgtaaagcgacgctgttacagcatcacgggcttatcgcttgt
gaagaaaatttagacaaagcgttgtggctggcgcatgaagtggaagtgctggcgcagctc
tatttaagtacgctggccattgtcgatccggtaccggtactggatgacgaggcgatcgct
atcgtactggagaaatttaaaacttacggattacgtattgaagagtga

DBGET integrated database retrieval system