KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3300
Entry
STY3300           CDS       T00064                                 

Definition
(RefSeq) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sty00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STY3300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sty02044]
    STY3300
Secretion system [BR:sty02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STY3300
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 1249574
NCBI-ProteinID: NP_457526
GeneDB: STY3300
UniProt: Q8Z3S0
Position
complement(3146822..3147307)
AA seq 161 aa
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTK
FVDLATPVLNEYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKP
VETMSLNFTKIKWQITAEKSDGAQQESRASVWDLAMDQIGK
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgcgatttttttaaagctcgacaatatcaaaggcgaaagccaggttgaaggcttt
gaagatcagatagagatcatgtcttatagccacaatgtggcaatgcaggtaaataacgat
gttagcctcactgagcggacttccgggcgtgcgcatgttggtgaaatgtcgctcaccaaa
tttgtcgacctcgccacgcctgtgctcaatgagtactgctgtagcgggaggctaattaga
accgcggtgctgacgttgtgccgcaatgacgacggcaaaatgcggtcgcttatcgtttat
accctgacaaacgtgctgatatcacaactcagtgttagcggcggcgccggcggtaagccg
gtggaaacgatgtcgctgaacttcacgaaaatcaaatggcaaatcactgccgagaaatca
gacggcgctcaacaggagtccagagcgtcagtatgggatctggcgatggaccagataggg
aaatga

DBGET integrated database retrieval system