KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3532Help
Entry
STY3532           CDS       T00064                                 

Gene name
oadA
Definition
(RefSeq) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00620  Pyruvate metabolism
sty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STY3532 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sty02000]
    STY3532 (oadA)
Enzymes [BR:sty01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     STY3532 (oadA)
Transporters [BR:sty02000]
 Other transporters
  Primary active transporters [TC:3]
   STY3532 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 1249785
NCBI-ProteinID: NP_457728
GeneDB: STY3532
UniProt: Q8XGX8
Position
complement(3373656..3375431)
Genome map
AA seq 591 aa AA seqDB search
MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAQLDDVGYGSLECWGGATFDACIRFLGED
PWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAFELVSEIKKRFEVRLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEGQLKGYDSRILVAQVPGGML
TNLESQLKQQNAADRLDQVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQARVLEGSAPVTCRPADLLKPELAELEADVRRQAQEK
GITLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPLPQAEAAQPVAKAEKPAASGIYT
VEVEGKAFVVRVSDGGDISQLTTAVPAASSAPVQAAAPAGAGTPVTAPLAGNIWKVIATE
GQSVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGDAVSVGDTLMTLA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgactattgccattaccgacgtcgtcctgcgtgacgcccaccagtctctgttcgccacc
cgcctgcgccttgacgatatgctgccgattgccgctcagctcgacgacgtgggctacggc
tcgctggagtgctggggcggcgccacctttgacgcctgtattcgttttctcggcgaagac
ccgtggctgcgcctgcgcgaactcaaaaaagccatgcccaaaaccccgctgcagatgctg
ctgcgcggccagaacctgctcggctaccgccactacgccgatgatgtggtggagcgcttc
gttgaacgcgcggtgaaaaacggcatggatgtgttccgcgtcttcgatgccatgaacgac
ccgcgcaatatgaaagccgccctgcaggcggtgcgcagccacggcgcgcacgcccagggg
acgctctcctacaccaccagcccggcgcacaccctgcagacctggctggacctgaccgaa
cagttgttagagaccggcgttgactcgattgccatcaaggatatgtccggcattctcacg
ccgatggccgcttttgagctggtgagcgaaatcaaaaaacgttttgaggtgcgcctgcac
ctgcactgtcacgccaccaccgggatggcggagatggccctgctgaaggctatcgaggcg
ggtgttgacggcgtggacacggcgatttcgtccatgagcgccacctacggccacccggcc
accgaggcgctggtggcgacgttggcaggtactgagcacgacaccgggctggatatcctg
aagctggaaaatatcgccgcgtacttccgcgaggtgcgcaaaaagtaccatgcctttgaa
ggccagctgaaaggctacgacagccgtattctggtggcgcaggtaccgggcgggatgctg
accaacctcgaaagccagctgaagcagcagaacgcggcggacaggctggaccaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggctttatcccgctggtcaccccgacctcg
cagattgtcggcacccaggcggtgctcaacgtcctgaccggcgaacgctacaaaaccatc
gcgaaggaaaccgccggcattctgaaaggcgaatacggccacaccccggtgccggttaac
gccgcgttacaggcccgcgtgctggaagggagcgctccggtgacctgccgcccggcggac
ctgctgaagccggagctggctgaactggaagcggacgtcaggcgccaggcgcaggagaag
gggattactctggcgggaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
atcggcctcaaattccttgagaaccgccataacccggcggcgtttgagccactgccgcag
gcggaagccgcgcagccggtggcaaaagcagagaagcctgccgcctccggtatctacacc
gtggaagtggaaggcaaagcctttgtggtgagggtcagcgacggcggcgatatcagccag
cttactacggctgttccggcggcctcttccgcaccggttcaggctgccgccccggcaggc
gccggcaccccggtcaccgcgccgctggcgggcaacatctggaaggtgattgccaccgaa
ggccagagcgtggccgaaggcgacgtgctgctgattctggaagccatgaagatggaaacc
gaaatccgcgccgcgcaggccggcaccgtccgcggtatcgcggtgaagtccggggacgcc
gtctccgtgggcgacaccctgatgacgctggcgtaa

DBGET integrated database retrieval system