KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3577Help
Entry
STY3577           CDS       T00064                                 

Gene name
fadB
Definition
(RefSeq) fatty acid-oxidizing multienzyme complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00071  Fatty acid degradation
sty00280  Valine, leucine and isoleucine degradation
sty00281  Geraniol degradation
sty00310  Lysine degradation
sty00362  Benzoate degradation
sty00380  Tryptophan metabolism
sty00410  beta-Alanine metabolism
sty00640  Propanoate metabolism
sty00650  Butanoate metabolism
sty00903  Limonene and pinene degradation
sty00930  Caprolactam degradation
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
sty01120  Microbial metabolism in diverse environments
sty01130  Biosynthesis of antibiotics
sty01200  Carbon metabolism
sty01212  Fatty acid metabolism
Module
sty_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STY3577 (fadB)
   00650 Butanoate metabolism
    STY3577 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STY3577 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STY3577 (fadB)
   00310 Lysine degradation
    STY3577 (fadB)
   00380 Tryptophan metabolism
    STY3577 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STY3577 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STY3577 (fadB)
   00281 Geraniol degradation
    STY3577 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STY3577 (fadB)
   00930 Caprolactam degradation
    STY3577 (fadB)
Enzymes [BR:sty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     STY3577 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STY3577 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     STY3577 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     STY3577 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 1249832
NCBI-ProteinID: NP_457769
GeneDB: STY3577
UniProt: Q8Z3C6
Position
3428004..3430193
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALK
IGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDIETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
ETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNNCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDDLLASVSQTKRDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRDKTRHNEPYYPPVEPA
RPVGSLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttataaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagcctcggc
caggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgctctaat
aaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctcgtcccc
gaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctggaagat
ttacccgtaccgacccttgccgccgtaaacggctatgcgctgggcggcgggtgtgaatgc
gtgctggcgaccgattaccgtctggcgacgccagacctccgtatcggtctgccggaaact
aaactgggcatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctgggcgcg
gacagcgcgctggagattatcgcggcaggtaaagatgtcggtgctgagcacgcgctgaaa
atcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgatagcggtg
ttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaactggaa
ccgttgaaactcagcaaaattgaagcggcgatgagctttaccatcgctaaaggcatggtc
gcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccattgaagcc
gccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgttccgctg
gcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatatgtaaaa
ggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagccgtactgggc
gcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccggtcatc
atgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaagctgctg
aacaaacagctggagcgcggcaagatcgacggtctgaagctggcgggcgtcatttcgacc
atccacccgactctcgattatgccggtttcgatcgcgtagatgttgttgtcgaagcggta
gtcgaaaatccgaaagtcaaaaaagcggtactggcggaaaccgagcagaaagtgcgccca
gaaaccgtgctggcctcaaatacctccaccatcccaattggcgaactggcaagcgccctg
gaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatgccgctg
gttgaaatcattcgcggcgagaagagttcagacgaaaccattgccaaagtcgtcgcctgg
gccagcaaaatgggcaagacaccgattgtagtcaacaactgccccggcttctttgttaac
cgcgtgctgttcccctatttcgccggtttcagtcaactgctgcgcgacggcgcggatttc
cgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcctatctg
ctcgacgtggtgggtattgataccgcccaccacgcgcaggcggtaatggcggcaggcttc
ccacaacggatgcagaaagagtatcgcgacgcgatcgacgcattgtttgacgccagccgt
tttgggcaaaaaaacggtctgggcttctggcgctataaagaagacagcaagggtaagccg
aagaaagaagaagatgctgcggtggatgacctgctggcaagcgtcagtcagacgaaacgc
gacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaagtggtt
cgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacagggcagc
gcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgaagtgccg
gaagggctgcgtgataaaacgcgccataacgaaccgtattatcccccggttgaaccagcc
cgtccggttggttctctgaaaacggcttaa

DBGET integrated database retrieval system