KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY3990Help
Entry
STY3990           CDS       T00064                                 

Definition
(RefSeq) permease
  KO
K02429  MFS transporter, FHS family, L-fucose permease
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Brite
KEGG Orthology (KO) [BR:sty00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sty02000]
    STY3990
Transporters [BR:sty02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Fucose:H+ symporter (FHS) family [TC:2.A.1.7]
    STY3990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 1250233
NCBI-ProteinID: NP_458145
GeneDB: STY3990
UniProt: Q8XEV7
Position
3855157..3856473
Genome map
AA seq 438 aa AA seqDB search
MNDKNIVQMPDGYLNKTPLFQFILLSCLFPLWGCAAALNDILITQFKSVFSLSNFASALV
QSAFYGGYFLIAIPASLVIKKTSYKVAILIGLTLYIVGCTLFFPASHMATYTMFLAAIFA
IAIGLSFLETAANTYSSMIGPKAYATLRLNISQTFYPIGAAAGILLGKYLVFSEGESLEK
QMAGMNAEQVHNFKVLMLENTLEPYKYMIMVLVVVMVLFLLTRFPTCKVAQTASHKRPSA
LDTLRYLASNARFRRGIVAQFLYVGMQVAVWSFTIRLALELGDINERDASTFMVYSFACF
FIGKFIANILMTRFNPEKVLILYSVIGALFLAYVALAPSFSAVYVAVLVSVLFGPCWATI
YAGTLDTVDNEHTEMAGAVIVMAIVGAAVVPAIQGYVADMFHSLQLSFLVSMLCFVYVGV
YFWRESKVRGNLAEVAAS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataaaaacatcgttcagatgcccgacgggtatctgaataagacacctctgttc
cagtttattttgttatcctgtttattcccgttatggggatgcgcagccgcgttaaatgat
attctgattacgcaatttaaaagtgtattttcgctgagcaactttgcttcggcattagta
caaagcgccttttatggcggttattttttaattgctattccggcctcgctggtcattaaa
aaaaccagttataaagtggcgatacttatcggcctgacgctatacattgtcggctgtacg
ctcttttttccggcgtcgcacatggcgacctacaccatgttcctcgcggcgattttcgcc
attgcgattggcctgagtttcctggaaacggcggcgaatacctacagttcgatgatcggg
ccgaaagcctacgccacgctgcggctgaatatcagccagaccttttatccgatcggcgcg
gcggcaggcattttattgggtaagtatctggtcttttccgaaggggaaagcctggaaaaa
cagatggcgggcatgaatgccgagcaagtccacaacttcaaggtgttgatgctggaaaac
actctggaaccctataagtacatgattatggttctggtagtggtgatggtactgttcctg
ctgacgcgttttccgacctgtaaagttgcgcaaaccgcgagtcataaacgtccctcggcg
ctggatacgctacgctatctcgccagtaacgcccgcttccgtcgcggtattgtggcgcag
ttcctgtatgtgggaatgcaggtggcggtctggtcgttcactattcgtctggcgctggag
ttaggcgatatcaatgagcgcgatgcctcaacctttatggtctacagcttcgcctgcttt
tttatcggcaagtttatcgccaacattctgatgacgcgcttcaacccggaaaaagtcctg
atcctttactctgtgatcggcgcgctgttcctggcctatgtggcgctggcgcccagcttt
agcgcggtatacgtggcggtgctggtcagtgttctgtttggcccctgctgggcgaccatt
tatgccggaacgctcgataccgtcgataacgagcataccgaaatggcgggggcggtcatc
gtgatggcgattgtcggcgcggcggtggttcccgcgattcagggctacgtggcggacatg
ttccactcgttacagctctcattcctggtttccatgctgtgctttgtttacgttggcgtt
tacttctggcgcgaaagcaaagtgcgcggcaacctggctgaagtcgccgcgtcctga

DBGET integrated database retrieval system