KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4085Help
Entry
STY4085           CDS       T00064                                 

Gene name
rfaD
Definition
(RefSeq) ADP-L-Glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00540  Lipopolysaccharide biosynthesis
sty01100  Metabolic pathways
Module
sty_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    STY4085 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sty01005]
    STY4085 (rfaD)
Enzymes [BR:sty01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     STY4085 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:sty01005]
 Unusual sugar
  STY4085 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR adh_short
Motif
Other DBs
NCBI-GeneID: 1250315
NCBI-ProteinID: NP_458217
GeneDB: STY4085
UniProt: P67913
Position
complement(3942888..3943820)
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQI
MSGEELGDIEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATY
GGRTSDFIESREYEKPLNVYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGESPKLFEGSENFKRDFVYVGDVAAVNLWFLESGKSGIFNLGTGRA
ESFQAVADATLAYHKKGSIEYIPFPDKLKGRYQAFTQADLTNLRNAGYDKPFKTVAEGVT
EYMAWLNRDA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttaccggcggcgcgggctttatcggcagcaatatcgttaaggccctgaat
gataaaggtatcaccgatattctggtggtggataacctgaaagacggcaccaagtttgta
aacctggtggatctgaacattgctgactatatggataaggaagatttcctgatccagatt
atgtccggagaagagctcggcgatatcgaagctattttccatgaaggcgcctgctcttcc
accaccgagtgggacggcaagtatatgatggataataactatcaatactccaaagagctg
ctgcactattgtcttgagcgcgaaatcccgttcctctacgcctcttctgccgccacctat
ggcggtcgcacgtctgatttcatcgaatcgcgtgaatacgaaaaaccgcttaacgtttac
ggctattctaaattcctgtttgatgaatacgtgcgccagatcctgccagaagcgaactcg
cagattgtcggtttccgctatttcaacgtctatggaccacgtgaaggccataaaggcagc
atggcaagcgtggcatttcatctgaatacacagttaaacaacggcgaaagtccgaaactg
tttgaaggcagcgaaaacttcaagcgcgacttcgtttacgtgggcgatgtggccgccgtt
aacctgtggttcctggaaagcggcaagtccggcatctttaacctgggcacaggccgcgcg
gaatctttccaggccgtcgccgacgcgacgctggcataccataaaaaaggcagcattgaa
tacattccgttcccggataagctgaaaggtcgctatcaggcgtttacgcaggcggattta
accaatctgcgcaacgcgggctacgacaaaccctttaagaccgtcgccgaaggcgtcacg
gagtatatggcctggctgaaccgcgacgcgtaa

DBGET integrated database retrieval system