KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4156Help
Entry
STY4156           CDS       T00064                                 

Gene name
yiaE
Definition
(RefSeq) 2-hydroxyacid dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00030  Pentose phosphate pathway
sty00260  Glycine, serine and threonine metabolism
sty00620  Pyruvate metabolism
sty00630  Glyoxylate and dicarboxylate metabolism
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
sty01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STY4156 (yiaE)
   00620 Pyruvate metabolism
    STY4156 (yiaE)
   00630 Glyoxylate and dicarboxylate metabolism
    STY4156 (yiaE)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STY4156 (yiaE)
Enzymes [BR:sty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     STY4156 (yiaE)
    1.1.1.81  hydroxypyruvate reductase
     STY4156 (yiaE)
    1.1.1.215  gluconate 2-dehydrogenase
     STY4156 (yiaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 1250381
NCBI-ProteinID: NP_458279
GeneDB: STY4156
UniProt: Q8Z2A8
Position
complement(4014615..4015589)
Genome map
AA seq 324 aa AA seqDB search
MKPSIILYKTLPDDLLHRLEAHFTVTQVPNLHPETVARHAQAFASAQGLLGTSETVNRAL
LEKMPALRAASTISVGYDNVEVDALTARKIVLMHTPAVLTETVADTVMALMLATARRVVD
VAERVKAGEWTESIGPAWFGVDVHHKTLGIVGMGRIGMALAQRAHFGFTMPVLYHARRRH
QEAEDRFNARYCDLDTLLQEADFVCVILPLTAETRHLFGATQFARMKSSAIFINAGRGPV
VDENALIAALQNGEIYAAGLDVFEQEPLSVDSPLLNMSNVVAVPHIGSATHETRYNMMAC
AVDNLIDALQGKIEKNCVNPQAAG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtccatcattctctacaaaaccctgcctgatgatttgctgcatcgcctggag
gcgcattttaccgtcacccaggtaccgaacctgcatccggaaacggtcgcgcgacacgcg
caggcatttgccagcgcgcaaggccttctgggcaccagcgaaaccgttaaccgcgcgctg
ctggaaaaaatgccggcgctacgcgcggcgtcgaccatctcggtgggatacgataatgtc
gaggtggacgcccttactgcccgcaaaatagtcctgatgcacacgcctgccgttttgacg
gaaaccgttgccgatacggtgatggcgttgatgctggccactgcccgccgcgtggtggac
gtcgcagaacgggttaaggcgggtgaatggacagaaagcattggcccggcatggtttggc
gtcgatgtgcatcacaaaacactcggtatcgttgggatggggcgtatcgggatggcgctg
gcgcagcgagcgcactttgggtttaccatgccggttctctatcacgcccgtcggcggcat
caggaggcggaagaccggtttaacgcccgctactgcgatctggatacgttgttgcaggag
gccgattttgtctgcgtgatcctgccactaacggcagaaacgcgacatctgtttggcgca
acacagtttgccagaatgaaatcgtccgccatttttattaatgccggacgcggcccggtg
gtcgatgaaaacgcgctgattgccgcgctgcaaaacggtgaaatatatgcggcaggtctg
gatgtctttgaacaggaaccgctatctgtggattcgcccctgctgaacatgtctaatgtc
gtcgcggtgccgcatattggctcggcaacgcatgagacgcgctacaacatgatggcctgt
gcggtggataatttgattgatgcgctgcagggaaaaatagagaagaactgcgtcaatccg
caagcggcgggataa

DBGET integrated database retrieval system