KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4294Help
Entry
STY4294           CDS       T00064                                 

Gene name
ompR
Definition
(RefSeq) two-component response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sty00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STY4294 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sty02022]
    STY4294 (ompR)
Two-component system [BR:sty02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   STY4294 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-GeneID: 1250511
NCBI-ProteinID: NP_458402
GeneDB: STY4294
UniProt: P0AA20
Position
4170266..4170985
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaattataagattctggtggttgatgacgatatgcgtctgcgggcgctactg
gaacgttatctgaccgagcagggcttccaggttcgaagcgtcgctaacgccgagcagatg
gatcgtctgctgacccgtgaatctttccatctcatggtactggatttaatgctgccaggt
gaagatggtctgtcgatttgtcgtcgcctgcgtagtcaaagtaatccaatgccgatcatt
atggtcacggcgaagggtgaagaggttgaccgtatcgtcgggctggaaatcggcgccgat
gactacattcctaaaccgtttaacccgcgcgagctgttggcgcgtatccgcgccgtgcta
cgtcgtcaggcaaacgaactgcccggcgcgccgtcgcaggaagaggccgttatcgcgttc
ggtaagttcaaactgaacctcggtacgcgcgagatgttccgtgaagatgaaccgatgccg
ctgaccagcggggagtttgcggtactgaaagcgttagtcagccatccgcgcgagccgctc
tctcgcgacaagctgatgaatctggcccgtggccgcgagtattccgcgatggaacgctcc
atcgacgtccagatctcccgcctgcgccgtatggtggaagaagatccggcgcatccgcgt
tatattcagaccgtatggggcctgggctacgtcttcgtaccggacggttctaaagcatga

DBGET integrated database retrieval system