KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4473Help
Entry
STY4473           CDS       T00064                                 

Gene name
acs
Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty00010  Glycolysis / Gluconeogenesis
sty00620  Pyruvate metabolism
sty00640  Propanoate metabolism
sty00680  Methane metabolism
sty01100  Metabolic pathways
sty01110  Biosynthesis of secondary metabolites
sty01120  Microbial metabolism in diverse environments
sty01130  Biosynthesis of antibiotics
sty01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sty00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STY4473 (acs)
   00620 Pyruvate metabolism
    STY4473 (acs)
   00640 Propanoate metabolism
    STY4473 (acs)
  Energy metabolism
   00680 Methane metabolism
    STY4473 (acs)
Enzymes [BR:sty01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     STY4473 (acs)
Lipid biosynthesis proteins [BR:sty01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   STY4473 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 1250688
NCBI-ProteinID: NP_458573
GeneDB: STY4473
UniProt: Q8Z1R0
Structure
PDB: 

Position
complement(4358832..4360790)
Genome map
AA seq 652 aa AA seqDB search
MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYRELHRDVCRF
ANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAIAGRIIDSSS
RLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGNDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacacataaacacgccattcccgccaacattgcggatcgttgcctgataaat
ccagagcagtatgagactaaatataaacagtctattaacgaccccgatacgttttggggc
gaacagggaaaaattctcgattggatcacgccgtaccaaaaagtgaaaaacacctccttt
gcgccaggcaatgtgtcgattaaatggtacgaggacggcacgctgaatctggcggcgaac
tgtcttgaccgccatttgcaggaaaatggcgatcgcaccgccattatctgggaaggcgat
gacgcgtcgcagagtaaacatatctcttatcgcgaactgcatcgcgatgtctgccgtttc
gcgaatacactgctggatctgggcattaaaaaaggcgatgtggtagcgatttatatgccg
atggtgccggaagcggcggtggcaatgttggcctgcgcccgcatcggtgcggtgcattcg
gtgatcttcgggggcttctcgccggaagccatcgccggacgcattatcgactccagctcg
cggctggtgatcaccgctgacgaaggtgtacgtgccggacgcagtatcccgctgaaaaag
aatgtcgatgacgcgctgaaaaacccgaatgtcactagcgttgagcatgtgatcgtcctg
aagcgcaccggcaacgacattgactggcaagaaggccgcgacctgtggtggcgcgatttg
attgaaaaagccagccctgagcaccagcctgaagcgatgaatgccgaagatccgctgttt
atcctttatacctccggctccaccggcaagccgaaaggcgtgctgcacaccaccggcggc
tatctggtctacgccgcgaccacctttaagtatgtctttgattatcaccctggcgatatt
tactggtgtaccgccgatgtgggttgggtgacggggcacagctatctgttgtatggcccg
ctggcctgcggcgcgaccaccttaatgtttgaaggcgtgccgaattggccaacgcccgct
cgcatgtgccaggtggtcgacaaacaccaggtcaacattctctataccgccccgacggcc
atccgcgcgctgatggcggaaggcgataaagccattgaaggcaccgaccgttcttcacta
cgcattctgggttccgtcggcgagccgatcaatcccgaagcgtgggaatggtactggaag
aagatcggcaaggaaaaatgtccggtcgtcgacacctggtggcagactgaaacaggcggt
tttatgatcacgccgctaccaggcgctatcgaactgaaagccggttccgccacccgtcct
ttctttggcgtacagcctgcgctggtggataacgaaggccatccgcaagaaggcgcgacg
gaaggcaatctggtcatcaccgattcctggccgggccaggcgcgcactctgttcggcgat
catgaacgttttgagcagacctatttctctacctttaagaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaggacggctattactggatcaccggtcgcgtggatgacgtgtta
aacgtctccggccaccgtctgggtacggcggaaatcgagtcagcgctggtggcgcatccg
aagatcgccgaagcggcggtggtgggtattccacacgctatcaaaggccaggcgatttac
gcttatgtgacgctcaaccacggcgaggagccgtcgccagaactgtacgcggaggtgcgc
aactgggtacgtaaagagattggcccactggcgacgccggacgtgctgcactggaccgac
tcactgccaaaaacccgttccggcaaaattatgcgccgcattttgcgcaaaatcgcggcg
ggcgataccagcaatctgggcgatacctcgactctcgccgatcctggcgtggtggagaaa
ctgctcgaagagaagcaggccatcgcgatgccgtcataa

DBGET integrated database retrieval system