KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4563Help
Entry
STY4563           CDS       T00064                                 

Definition
(RefSeq) hypothetical protein
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4400
Motif
Other DBs
NCBI-GeneID: 1250768
NCBI-ProteinID: NP_458649
GeneDB: STY4563
UniProt: Q8Z1K1
Position
4444208..4444966
Genome map
AA seq 252 aa AA seqDB search
MSTEKNSSQSSPPPRKPPGLLTLVLWIWPVRLLAFLLVSWMAGVFIEWAGMFFFWSDQGA
LHSQSVMNKELGYLSADFTQSLIFSSPSVTTMGWISSAYQWAFVDSGLLTWIQKEQRETL
SSSDSVVFFLGQVQAWLLSVLSDYLLALVYVTVVFAVRVLILVLSIPLFVLVIIVAVIDG
LCRRDLRRYGAGYESSFLYHHAKRFVKPAVYLPCLLYLSWPASIYPNLLLLPGALLLGLA
VTVVTSTFKKYL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagaaaaaaacagctctcaaagttctccaccaccgcgcaagccaccaggtttg
ctgacccttgttttgtggatctggccagtcaggcttttggcttttctgctggtatcctgg
atggctggtgtttttattgaatgggcaggaatgttttttttctggtcagatcagggagct
ttgcattcccagtccgttatgaataaagaacttggctatttatcagcagattttactcaa
agccttattttttcttcaccatcagtaactacgatgggctggatttcgtcagcttaccaa
tgggcatttgtggacagtggattactcacctggattcagaaagaacaaagggagacatta
agcagttctgactctgttgttttttttctgggacaagtgcaggcctggttattatcagtg
ttaagcgattatctgcttgcgctggtttatgtcaccgtcgtttttgccgtcagggtatta
attcttgttttatccatcccgttatttgttctggttatcatcgtcgctgttatagacggg
ttgtgtcgtcgtgacctgagacgttacggggcgggttatgagtcgagttttctgtatcac
catgccaaacggtttgttaaaccggctgtttatctcccttgcttactttacttgtcatgg
cctgcgtcgatttatccaaatctgttacttctgcccggggcattgttactgggactggcg
gttactgtagtgacatctacattcaaaaaatatctgtga

DBGET integrated database retrieval system