KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4577Help
Entry
STY4577           CDS       T00064                                 

Definition
(RefSeq) hypothetical protein
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1250781
NCBI-ProteinID: NP_458662
GeneDB: STY4577
UniProt: Q8Z1I8
Position
4454829..4456259
Genome map
AA seq 476 aa AA seqDB search
MRSQSILSVCLMLGIVSSGPLSAALLDAPTLSGDGYGKSVNGAVSDKLFYSIGGGSVIST
PGTMYGMKRIGLDAGLSSDLMCGNFDIKTTVGNQLNGVTNGFKDLMGDVITGATGAVSSM
PAMILQRANPGLYEMITNGVLQAGLAFDKSKLNCESMANKLADYTLGDKSSWTESAVREE
YKEAVSASGGDALRAEEARTKASGKEGATWVGGKKAGGKGQPAIQPTRDLAKAGYNMMNN
LSVTSNSTVSAGSCKGSACQKFKNSEEAAAAVVKVLGDRSIRTCKDATECGSGGIDNAQG
TTIAGTGFAPMLEDTTKENLEQLVKLVNGTEAPTQANLDKIKSGSLKVTRGVIDALKRDP
DAGALVQRLAGELAMSDTIETGLAMRRMLTTGQSEPNAADQPQAMAEADRRIEALDRELN
SLKLEMELRREVAKNTALVVVAREENRSVTNPQKESQTNADTRLSELETRKPGDSQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagatctcaatccattttatccgtctgtctcatgctgggtatcgtcagttcgggaccg
ttaagtgctgcattactggatgcccccacgttgagtggtgatggatatggaaagtcagta
aatggcgcggttagtgacaagctgttttacagcattggtggtggttcggtgatttccact
cccgggacgatgtacggaatgaaacgtatcgggctggatgccggactgagcagtgatttg
atgtgtggcaactttgatataaagactactgtcggaaaccagcttaatggcgtcacgaat
ggtttcaaagatttgatgggggatgtgatcaccggtgcgaccggggcggtctcaagtatg
ccggcgatgatccttcagcgagcaaatccgggtttgtatgaaatgatcaccaatggtgta
cttcaggcaggtctggcttttgacaaatcgaaactgaattgtgaaagcatggccaacaag
ctggctgattacactttgggtgacaagagcagctggacagaatcagctgtgagggaagag
tacaaggaggcggtcagtgccagtggcggggatgcgctgcgggcagaagaggccagaacc
aaagcttcaggtaaggagggcgctacctgggtaggcgggaagaaagccggagggaaaggc
cagcctgccattcagccaacgcgtgatctggctaaagcaggatacaacatgatgaataac
ctgagcgttaccagcaacagcacggtatccgccggtagttgcaaggggtcagcatgccag
aaatttaaaaactctgaagaagctgcagcagcggtcgtaaaagttctgggcgatcggagt
attcgcacctgtaaagatgccacagaatgcggaagcggcgggattgataatgcccagggc
acgacaattgccggtaccggttttgctcccatgcttgaggatacaaccaaagagaatctg
gaacagctggtaaagcttgtaaatggtactgaggctccgactcaggccaatctggataaa
attaaaagtggcagccttaaggtaacgcgtggtgtcatcgatgccctgaaacgcgatcct
gatgccggtgcgttggttcagagactggctggcgaactggccatgtccgacacgattgaa
accggtctggcgatgcgtcgcatgttaacgactggccagtctgaacccaatgcagctgat
cagcctcaggcaatggctgaagccgatcgccgtattgaagctctcgatcgtgagcttaac
tctcttaagctggagatggaactgcgtcgggaagtggcaaaaaataccgcgctggttgtg
gttgcgcgcgaagaaaatcgttcggtcaccaatcctcaaaaagaatcgcagactaatgct
gatacccggctgagtgagcttgaaacgcgtaaaccaggggacagccaatga

DBGET integrated database retrieval system