KEGG   Salmonella enterica subsp. enterica serovar Typhi CT18: STY4652Help
Entry
STY4652           CDS       T00064                                 

Gene name
vexD
Definition
(RefSeq) Vi polysaccharide exporter inner-membrane protein
  KO
K22922  Vi polysaccharide transport system permease protein
Organism
sty  Salmonella enterica subsp. enterica serovar Typhi CT18
Pathway
sty02010  ABC transporters
Module
sty_M00857  Salmonella enterica pathogenicity signature, Vi antigen
Brite
KEGG Orthology (KO) [BR:sty00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STY4652 (vexD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sty02000]
    STY4652 (vexD)
Transporters [BR:sty02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Vi polysaccharide transporter
    STY4652 (vexD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3216
Motif
Other DBs
NCBI-GeneID: 1250853
NCBI-ProteinID: NP_458731
GeneDB: STY4652
UniProt: P43111
Position
complement(4512573..4513877)
Genome map
AA seq 434 aa AA seqDB search
MENSERIKKWKEERAKVAQESRASRLQQKEDERALRQTEKSADAKSHHNPDAGWSATDAD
SVRRASLVIKERRVQQAKQSLRRLFLYIALPLLVIMLMSWILTSHFYSADATFIVQTDAS
QDNFSGTSFFGAGNKMSEGFQVREFILSKEMMDRMEKELGFLSYFAQDDIALFSRFHAPL
GINDDPYRYYLSKVSVAVDIQQGMLRLNVKARSAKQAEFFAQRILSFAEQHVNTVSARMQ
KERILWLENDVKSAQENLGAARLELLKIQHIQKDIDPKETITAIYQLIAGFETQLAEAKA
EYAQLMVNGLDQNPLIPRLSAKIKVLEKQIGEQRNRLSNKLGSQGSSESLSLFEDLRLQS
EIAKARWESALQTLQQGKLQALRERQYLLIISQPMAESDTTRYADGTKWLLFFVLLGITY
LVTSLLITIRRMRE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaattcagaacgtattaaaaaatggaaagaagaaagagcgaaggtagcacaagaa
agccgagcctcgcggctacaacaaaaagaggatgaacgcgcccttcgccagacggaaaaa
tcggccgatgcaaaaagtcatcataacccagacgccgggtggtctgcgacggatgctgat
tctgtccgtagagcgtcattagttattaaagagcgacgtgttcagcaagccaagcaatcg
ctacgtcggctctttctttatattgctttgccgctgctggttattatgcttatgtcgtgg
attttaacatcgcatttttatagtgcggatgccacctttattgtgcaaactgatgccagc
caggataatttttctggaacatctttctttggtgcaggcaataagatgtcggagggcttt
caggttcgcgagtttatactttcgaaagaaatgatggatcggatggaaaaagagctcggt
tttttatcttatttcgcgcaagacgatatcgcattattttcccgcttccacgcgccgctg
ggtattaatgatgatccttatcgttactatttatcaaaagtctcggttgctgtcgatatt
caacagggcatgctgcgtttaaacgtgaaggcacggagtgcgaaacaggctgagtttttt
gcccagcgcattctgtcttttgctgaacagcacgttaataccgtttcagcgcggatgcag
aaggaacggattttgtggctggaaaatgatgttaaatcggcccaagagaatctgggggca
gctcgacttgaattgctaaaaatacagcatatacaaaaagatattgacccgaaggaaacc
ataaccgctatttatcaattaattgctggctttgaaacgcagttggcggaggcgaaagcg
gaatacgcgcaattaatggtgaatggtttggatcagaacccccttattcctcgcctgtcg
gccaaaatcaaggtactggaaaagcagatcggcgaacaacgtaaccgcttgtcaaataag
ttagggtcgcaaggctcttcagaaagcctgtccttatttgaagatcttcgcctgcagagc
gagatcgccaaagcacgctgggaatctgccttacagaccttacagcaagggaagcttcaa
gctctacgtgagagacagtatttgctgatcatttctcaaccgatggctgagtctgacacc
actcgctatgccgatggaacaaagtggttactgttcttcgtgttgctgggcatcacgtac
ctggtgacttctctcctgataaccatcaggcggatgcgtgaataa

DBGET integrated database retrieval system