KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_000667Help
Entry
SPYALAB49_000667  CDS       T02019                                 

Definition
(GenBank) pseudouridine synthase, RluA family protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Brite
KEGG Orthology (KO) [BR:stz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:stz03009]
    SPYALAB49_000667
Enzymes [BR:stz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SPYALAB49_000667
Ribosome biogenesis [BR:stz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SPYALAB49_000667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: AEQ24271
Position
638951..639841
Genome map
AA seq 296 aa AA seqDB search
MEINVITSGQRLDKALADLSPLSRGQANDQIKQGLVLVNGQQKKAKYTVQAGDVICFELP
KEEVLEYQAQDIPLDIIYEDDALAIINKPQGMVVHPSAGHPSGTMVNALMYHIKDLSSIN
GVVRPGIVHRIDKDTSGLLMVAKTDAAHQALAEELKAKKSLRKYLAIVHGNLPNDRGMIE
APIGRSEKDRKKQAVTAKGKEAVTRFTVLERFGDYSLVELQLETGRTHQIRVHMAYIGHP
VAGDPLYGPRKTLSGHGQFLHAKTLGLTHPMTGKEMIFTVEAPEIFQKVLKLLRKK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaatgtgataacatcggggcaacgcttggataaggcactagctgatttaagt
cccctgtcacgtggtcaagccaatgaccaaattaagcaaggccttgttttagttaatggt
cagcaaaaaaaggctaaatatacggttcaagcaggagatgtgatttgttttgaactccct
aaagaagaagtcttagagtaccaagctcaggatattcccttggacattatctatgaagat
gatgctctcgccattattaacaagccacagggaatggtagttcacccttcggcgggacac
ccttcaggaacaatggttaatgccttgatgtatcatatcaaggatttgtcctcaatcaat
ggtgtggttcgtccaggaattgttcatcggattgataaggacacctcaggtctcttaatg
gtagctaaaacagatgcagctcatcaagccttggcagaagaattaaaggctaaaaaatct
ctcagaaaatacctcgccattgtccatggaaacctaccgaatgatcgcgggatgattgaa
gctcctataggtcgtagcgaaaaggaccgtaaaaaacaggctgttacagcaaaaggcaaa
gaagcagtgacacgttttacagtgctagaacgttttggcgattacagtctagtggaatta
caactggaaactggtcgaacgcaccaaattcgtgttcatatggcctatattggtcatcct
gttgctggggaccctttatatggaccacgtaagacactatcaggtcatggtcaatttctt
catgcaaaaacattgggattaacgcatcctatgacaggaaaagaaatgatatttactgtt
gaagctcccgaaatttttcaaaaggtgttaaagctgctaagaaaaaaataa

DBGET integrated database retrieval system