KEGG   Streptococcus pyogenes Alab49 (serotype M53): SPYALAB49_001385Help
Entry
SPYALAB49_001385  CDS       T02019                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stz  Streptococcus pyogenes Alab49 (serotype M53)
Pathway
stz00071  Fatty acid degradation
stz00072  Synthesis and degradation of ketone bodies
stz00280  Valine, leucine and isoleucine degradation
stz00310  Lysine degradation
stz00362  Benzoate degradation
stz00380  Tryptophan metabolism
stz00620  Pyruvate metabolism
stz00630  Glyoxylate and dicarboxylate metabolism
stz00640  Propanoate metabolism
stz00650  Butanoate metabolism
stz00900  Terpenoid backbone biosynthesis
stz01100  Metabolic pathways
stz01110  Biosynthesis of secondary metabolites
stz01120  Microbial metabolism in diverse environments
stz01130  Biosynthesis of antibiotics
stz01200  Carbon metabolism
stz01212  Fatty acid metabolism
stz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPYALAB49_001385
   00630 Glyoxylate and dicarboxylate metabolism
    SPYALAB49_001385
   00640 Propanoate metabolism
    SPYALAB49_001385
   00650 Butanoate metabolism
    SPYALAB49_001385
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPYALAB49_001385
   00072 Synthesis and degradation of ketone bodies
    SPYALAB49_001385
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPYALAB49_001385
   00310 Lysine degradation
    SPYALAB49_001385
   00380 Tryptophan metabolism
    SPYALAB49_001385
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPYALAB49_001385
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPYALAB49_001385
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPYALAB49_001385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stz04147]
    SPYALAB49_001385
Enzymes [BR:stz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPYALAB49_001385
Exosome [BR:stz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPYALAB49_001385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AEQ24966
Position
1327656..1328843
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLATQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYAISREEQDQFAL
ESQEKAAKALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagatatggtttgcggttctggacttaaagcaatccaattagctacgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtggaaaacatgtcacag
gcagcctatgtgtcaactcagcaccgctttggtcaacgtcttggtaatagtcaattgatt
gatactcttgttcatgatggtttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatgccatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctaaggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagatcctttaattgttacgacggatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccgttactgctggaaatgcctcaggaataaatgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgacttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gtgaatgggggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system