KEGG   Sulfurimonas autotrophica: Saut_0220Help
Entry
Saut_0220         CDS       T01316                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
sua  Sulfurimonas autotrophica
Pathway
sua03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sua00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Saut_0220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sua03011]
    Saut_0220
Ribosome [BR:sua03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Saut_0220
  Bacteria
    Saut_0220
  Archaea
    Saut_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 RII_binding_1 ptaRNA1_toxin
Motif
Other DBs
NCBI-ProteinID: ADN08269
UniProt: E0UTN8
Position
214167..214484
Genome map
AA seq 105 aa AA seqDB search
MARALLKFIRVSPIKSRLIAREVQGMNAEEAMAALEFTPNKAAKIISKVIASAVANSGSE
AEDCVITSCRVDNGPVLKRFRPRARGMASGIRKPTAHILVEVEGK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctagagcattattaaaatttatccgtgtatcacctatcaaatctcgtcttattgcg
cgtgaagtgcagggtatgaatgctgaagaagctatggcagctttagaattcactccaaat
aaggcggcaaaaattatctctaaagtaattgcatctgcagttgctaacagtggtagtgaa
gctgaagattgtgtaattacatcatgtcgtgttgacaatggtccagtacttaaacgtttc
cgcccacgtgctcgtggtatggcgtctggtattagaaaaccaacagcacatatcttagta
gaagtagagggtaaatag

DBGET integrated database retrieval system