KEGG   Sulfurimonas autotrophica: Saut_0556Help
Entry
Saut_0556         CDS       T01316                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sua  Sulfurimonas autotrophica
Pathway
sua00010  Glycolysis / Gluconeogenesis
sua00620  Pyruvate metabolism
sua00640  Propanoate metabolism
sua00680  Methane metabolism
sua00720  Carbon fixation pathways in prokaryotes
sua01100  Metabolic pathways
sua01110  Biosynthesis of secondary metabolites
sua01120  Microbial metabolism in diverse environments
sua01130  Biosynthesis of antibiotics
sua01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sua00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saut_0556
   00620 Pyruvate metabolism
    Saut_0556
   00640 Propanoate metabolism
    Saut_0556
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saut_0556
   00680 Methane metabolism
    Saut_0556
Enzymes [BR:sua01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Saut_0556
Lipid biosynthesis proteins [BR:sua01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Saut_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C CHDNT
Motif
Other DBs
NCBI-ProteinID: ADN08605
UniProt: E0UPL3
Position
536018..537769
Genome map
AA seq 583 aa AA seqDB search
MQNNWIVKKKSDFLVEPNLLDYEKVYNSFKWEDVAKEFDGLPSGGLNIAHEAIDRHADSD
KADKVALLWLGEKGQKVSYTYMQMKKETAKFANVLKSLGIKKGERIYTLSPRLPELYIGA
IGILKNLSVMCPLFSQFGPGPILQRMQSGDATALLTTQKLFNKKIRPMLNELKGLKYILL
IDAEEDENEIIRSLPKLMQEASDEFEIPPTDPEDMSLLHFTSGTTGMPKGVVHVHKAIYT
HWMTGKYVLDFHEHDNYWCTADPGWVTGTSYGIITPWVHGVTNIVDESEFNANRWYEILQ
NEKVSVFYTAPTAIRRLMRIDNEPTEEYDLSHLRLIQSVGEPLNPEAVIWGVEKLKMAIH
DNWWQTETGGIMIANLISQTVRPGSMGRPLPGITAAIVRQNGDGTVTEVTEPGKDGDLAL
RPGWPSMFRAYLHNEEKYKKSFVGGWYISGDLAYKDEDGYYWFVGRADDIIKTSGHMVGP
FEVESALMEHPAVAEAGVIGKPDELIGQLVKAFVSLKHGYEPTEELKRELIGFARKKLGA
AVAPKEIEFQEKLPKTRSGKIMRRLLKAREMGLPEGDTSTLEE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataattggattgtgaaaaagaaaagtgattttttagttgaaccgaatctttta
gattatgaaaaagtctataactcttttaaatgggaagatgtagcaaaagagtttgacggt
ttgccctcaggtggattaaacatcgctcatgaagcaattgaccggcatgctgattctgat
aaagccgataaagtggctttattatggcttggagagaaagggcagaaagtaagctataca
tatatgcagatgaaaaaagagacggcgaagtttgccaatgtattaaaatcattaggcatt
aaaaaaggggaaagaatttatacactttctccgagattgccggagctttacatcggagct
ataggtatacttaaaaacctgagcgtgatgtgtcctcttttctcacagtttggtcccggt
cctatactgcagcgtatgcaaagcggtgatgcgacggctcttctaacaacccaaaaactt
tttaataaaaaaatccgtccgatgctcaatgaacttaaagggttgaaatatatactttta
atagatgccgaggaagatgaaaatgagataatacgttcacttccaaaacttatgcaagag
gcttcggacgaatttgaaattcctccaactgatcctgaggatatgtcactgctgcacttt
acaagcggaacgacaggtatgccaaaaggtgtagttcacgtgcataaagcaatatataca
cactggatgacaggcaaatatgttcttgattttcatgagcatgataactactggtgtact
gccgatccgggttgggtaacggggacctcatacggaattattactccatgggtgcatggc
gtgactaatattgttgatgaatctgaatttaatgcaaacagatggtatgagatactgcaa
aatgaaaaagtcagtgttttttatacggcaccgacagccatacgacgtttgatgagaatc
gataatgaaccgactgaggagtatgacctttctcatctgcgccttattcaaagtgttggc
gaaccgctgaatcctgaagctgttatatggggtgttgaaaaactgaaaatggctatacat
gacaactggtggcagactgaaacaggcggcataatgatagcaaacctaatatctcaaaca
gtaagaccaggctcgatgggacggcctcttcccggaataactgcggcaatcgttcgtcaa
aatggggatggaacggtaacggaggtaacagagcctggaaaagatggagatttggctctt
agacccggctggccgtctatgtttagagcgtatctgcataatgaagaaaaatataaaaaa
tcttttgtcggtggatggtatatctcaggagacttggcttataaagatgaagacgggtat
tattggtttgtcggccgtgcagatgatattataaaaacatccggacacatggtaggtcct
tttgaggttgaaagcgccctgatggagcaccctgcggttgccgaagctggagttatcggt
aaaccggatgagcttatcggacagcttgtcaaggcttttgtgtctttaaaacacgggtat
gagccgacagaagaattaaaacgggaacttattggttttgcacgcaaaaagctaggtgca
gcagtagctccaaaagagatagagtttcaagaaaagcttcctaaaacccgtagcggcaag
attatgagaagactgttaaaagcaagagaaatgggattgcctgaaggtgatacttctacc
ttggaagagtaa

DBGET integrated database retrieval system