KEGG   Sulfurimonas autotrophica: Saut_2031Help
Entry
Saut_2031         CDS       T01316                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
sua  Sulfurimonas autotrophica
Pathway
sua00860  Porphyrin and chlorophyll metabolism
sua00970  Aminoacyl-tRNA biosynthesis
sua01100  Metabolic pathways
sua01110  Biosynthesis of secondary metabolites
sua01120  Microbial metabolism in diverse environments
Module
sua_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sua00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Saut_2031
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Saut_2031
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sua01007]
    Saut_2031
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sua03016]
    Saut_2031
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sua02048]
    Saut_2031
Enzymes [BR:sua01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Saut_2031
Amino acid related enzymes [BR:sua01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Saut_2031
Transfer RNA biogenesis [BR:sua03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Saut_2031
 Prokaryotic Type
   Other AARSs
    Saut_2031
Prokaryotic defense system [BR:sua02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Saut_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ADN10074
UniProt: E0URI8
Position
2014890..2016281
Genome map
AA seq 463 aa AA seqDB search
MVITRFAPSPTGYLHIGGLRTALFSYLWAKRNNGKFVLRIEDTDKARNSEEATEAILNAF
KWLGLEADGEITYQSKRENIYKKYIQQLLDEGKAYKCYMSKEELDALRETQMANKERTKY
DGKYRDFCGTVPEGIEPVIRIKAPLSGEIIVHDGVKGDISFQAEDILDDFVIARADGSPT
YNFVVAVDDALMGINEVIRGDDHLSNTPKQIVVYEALGFEIPKFYHVPMIHNAQGKKLSK
RDGATDVMAYKEMGYLPQALLNFLVRLGWSHGDQEIFSMDEMKELFDPKDINKSASIYNT
EKLDWLNAHYIKNTSNEELVELLTDFGVVLSSHDKKEILLDALKERAKTLKELAELTNEV
VTTPKSYDEKASKKAFKGNAVEVLEVFANRLAEAQELHLPVDYHHIMEKVVQEMEIGFGK
IGQPLRVALLGKLSGPGLDVVMAVLGRDETLSRIANAVLAHAN
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggttattacacgttttgctccaagtcctacaggatacttacacatcggcggtttacgc
actgctcttttttcttacctttgggcgaaaagaaacaatggtaaatttgttcttcgcata
gaagataccgataaagcaagaaactccgaagaagcaacagaggcgattttaaatgctttt
aagtggctcgggcttgaggctgacggagagatcacctaccaaagtaaacgtgaaaatatc
tacaaaaaatatatacaacagctgcttgatgaaggcaaagcctacaaatgctatatgagc
aaagaagagcttgatgcactgcgcgaaacacagatggcaaataaagaacgcacaaaatat
gatggaaaatatcgtgatttttgtggtactgtgccggaaggtattgagccggttatacgc
atcaaggcacccctaagcggtgaaattatagtccatgacggcgtcaaaggagacatctct
tttcaagcagaagatattttggatgattttgtcatcgccagagctgacgggagccctact
tataactttgtcgtagccgttgatgatgccttaatgggcatcaatgaagtcattcgagga
gatgatcacctctcaaacacgccaaaacagatagtcgtctatgaagcgcttggatttgaa
ataccaaaattttaccatgtgcctatgattcacaatgctcagggcaaaaaactctcaaaa
cgtgacggtgcgacggatgttatggcatacaaagagatgggttacctgcctcaagccctt
ttaaactttctcgtacgtcttggttggagtcacggcgatcaagaaattttttctatggat
gagatgaaagaactttttgatccaaaagatatcaataaatcagcttccatttacaacaca
gaaaagctcgactggctcaatgcccattacatcaaaaacacatcaaatgaagagcttgtt
gaactgcttactgatttcggcgtagtgctgagttcacatgataaaaaagagattttacta
gatgcccttaaagagagagcaaaaacattaaaagagctggcagagcttacaaatgaggtc
gttaccacacctaaatcatatgatgaaaaagcatccaaaaaagcttttaaaggcaatgcc
gtagaagttcttgaagtgtttgcaaacagattggctgaagcacaggaactgcatcttccg
gttgactatcatcacataatggaaaaagttgtccaggagatggaaataggcttcggaaaa
attggccagcctcttcgtgttgcacttcttggtaaactcagcggaccgggacttgatgtc
gttatggcagtcctcggacgtgatgaaacactttctcgtattgcaaacgctgtacttgct
cacgccaactaa

DBGET integrated database retrieval system