KEGG   Sulfurimonas autotrophica: Saut_2155Help
Entry
Saut_2155         CDS       T01316                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sua  Sulfurimonas autotrophica
Brite
KEGG Orthology (KO) [BR:sua00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sua03009]
    Saut_2155
Enzymes [BR:sua01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Saut_2155
Ribosome biogenesis [BR:sua03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Saut_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 XRN1_D2_D3 S4
Motif
Other DBs
NCBI-ProteinID: ADN10197
UniProt: E0USA4
Position
complement(2144243..2145151)
Genome map
AA seq 302 aa AA seqDB search
MPFVRKRMFAPKKQKAFLYLIQELGYTQKEAQRLIAKGRLFVSGKPMTKTAGEIEGEFEF
IYFEPITKGLEPTYEEEEFVIFDKPSGVLIHPQNRYTPYSLIDELKYQYGRDANITHRID
QETSGLVLCAKNKQSERDIKMMFEQRDMKKKYLAFVHGHFEKELTVEAPLLRAEDESAIV
RMVVKVDEKGKASKTDFKPLQYFSEVDMTLVECSPYTGRQHQIRVHLFHVKHPIVGDPIY
GQSEENIIKFLERELSEEERIKYSGAKRLLLHASELGFELYGRSYHIKSKVDFLKTSLLY
VM
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgccatttgttagaaagagaatgttcgcaccgaaaaaacaaaaagcttttttatattta
atacaagaacttggatatacacaaaaagaagcacagcgtcttattgccaaaggtagactg
tttgttagtgggaaacccatgacaaaaacagcaggtgaaatagaaggtgaatttgaattt
atctattttgaaccaattacaaaaggactggagcctacatatgaagaagaagagtttgta
atatttgataaaccaagcggcgtgcttattcatcctcaaaacagatatacgccctattcc
cttatagatgaattaaaataccaatacggcagggatgcaaatataacgcatagaattgat
caggaaactagcggactagttttatgtgctaaaaataaacaaagcgaacgtgatattaaa
atgatgtttgagcaaagagatatgaagaaaaaatatttggcatttgtgcatggtcatttt
gaaaaagaacttacagtagaagcaccactgctcagagcagaagatgagagtgcaatagtt
cgcatggtggtaaaggttgatgaaaaaggcaaagcttcaaaaactgacttcaagccgctg
caatatttttctgaagttgatatgacacttgttgaatgttcaccatatacaggaagacaa
catcaaattagagtgcatttgtttcacgtgaaacatccaattgtgggtgatcctatttat
ggacagagtgaagaaaatattattaaatttttagaacgggaattgtcggaagaagaaaga
ataaaatacagcggtgctaagcgattgcttttacatgcaagtgaattgggctttgagtta
tatggaagaagttatcatataaaaagtaaagtagactttttaaaaacatctttgttatat
gtaatgtga

DBGET integrated database retrieval system