KEGG   Sulfitobacter sp. AM1-D1: BOO69_01750Help
Entry
BOO69_01750       CDS       T04555                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam00010  Glycolysis / Gluconeogenesis
suam00020  Citrate cycle (TCA cycle)
suam00620  Pyruvate metabolism
suam01100  Metabolic pathways
suam01110  Biosynthesis of secondary metabolites
suam01120  Microbial metabolism in diverse environments
suam01130  Biosynthesis of antibiotics
suam01200  Carbon metabolism
Module
suam_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BOO69_01750
   00020 Citrate cycle (TCA cycle)
    BOO69_01750
   00620 Pyruvate metabolism
    BOO69_01750
Enzymes [BR:suam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     BOO69_01750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: APE42279
UniProt: A0A1J0WD76
Position
complement(345477..347075)
Genome map
AA seq 532 aa AA seqDB search
MTFGRVNPQFRLEDQQITGLGNVYYNLMEPALIETALKREEGTLGQGGSFLVTTGKFTGR
SPKDKHVVKTDSVADKIWWENNAAMSPEGFDALYDDMIAHMQGKDYFVQDLVGGADPRHA
INVRMITELAWHGLFIRTMLRRPDRADLDDFIADFTVINCPTFQADPKKHDCRSETVIAM
NFDRKMILIGGTEYAGENKKSVFTLLNYLLPEKNIMPMHCSANHATGNPVDTAVFFGLSG
TGKTTLSADPQRTLIGDDEHGWSDHGTFNFEGGCYAKTINLSPEAEPEIYATTTKFGTVI
ENMVYDEETKELDFEDDSLTANMRCAYPLHYISNASKKAVGGHPKNIIMLTCDAFGVLPP
IARLTPAQAMYHFLSGFTSKVAGTERGVTEPEPTFSTCFGAPFMPRRPEVYGSLLREKIA
EHGATCWLVNTGWTGGAYGTGSRMPIKATRNLLTAALEGSLADVKYRKDPNFGFEVPVAV
DGVPDILLDPRRTWDDPESYDRQAAKLVAMFSENFEQYMAHIDDDVKAAAIG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacatttggacgggtaaacccgcagttccgccttgaagatcagcagatcacgggcctg
ggcaatgtctattacaacctgatggaaccggccctgatcgaaaccgcgctgaagcgcgaa
gagggaacactgggccagggcggctcgttcctggtgacgaccggcaagttcaccggccgg
tcgcccaaggacaagcacgtggtcaagaccgacagcgtggcggacaagatctggtgggaa
aacaacgccgccatgtcgcccgaaggtttcgacgcgctctatgacgacatgatcgcgcac
atgcaggggaaggactacttcgtccaggatctcgtcggcggcgcggacccccgtcacgcc
atcaacgtgcgcatgatcacggaactcgcctggcacgggctgttcatccgcaccatgctg
cgccgccccgaccgtgccgacctcgacgatttcatcgccgacttcaccgtcatcaactgc
ccgacctttcaggccgaccccaagaagcacgactgccggtcggaaaccgtcatcgcgatg
aacttcgaccgcaagatgatcctcatcggcgggacggaatacgcaggcgagaacaagaag
tcggtgttcaccctgctcaactatctgctgccggaaaagaacatcatgccgatgcactgc
tccgccaaccatgcaaccggcaatccggtggacacggcggtgttcttcggcctgtccggc
accggcaagaccaccctgtccgccgacccgcagcgcacgctgatcggcgatgacgagcac
ggctggtcggatcacggcaccttcaacttcgaaggcggctgctacgccaagacgatcaac
ctctcgcccgaggcagagccggagatctatgccaccacgacgaaattcggcaccgtgatc
gagaacatggtctacgacgaagagaccaaggagctggacttcgaggatgacagcctgacc
gcgaacatgcgctgcgcctatcctctgcattacatctcgaatgccagcaagaaggccgta
ggcggccatcccaagaacatcatcatgctgacctgcgacgccttcggtgttctgccaccg
atcgcccggctgacgccggcgcaggccatgtaccacttcctctccggcttcacctccaag
gtcgcgggaacggaacgtggcgtgacggaacccgaaccgaccttctccacctgcttcggc
gcgcccttcatgccgcgccgccccgaggtctacggcagcctgctgcgcgaaaagatcgcc
gagcacggcgcgacatgctggcttgtgaacaccggctggaccggcggcgcctacggtacc
ggcagccggatgccgatcaaggcaacacgcaatctccttaccgccgcgctcgaaggctcc
cttgcggacgtgaaatatcgcaaggatccgaacttcggcttcgaagtgccggtggcggtg
gatggtgtgccggacatcctgctggacccccgccgcacctgggacgatcccgaaagctat
gaccgtcaggcggccaagctggtcgccatgttctcggagaacttcgagcagtacatggcg
cacatcgacgacgacgtgaaggcggcggccataggctga

DBGET integrated database retrieval system