KEGG   Sulfitobacter sp. AM1-D1: BOO69_03640Help
Entry
BOO69_03640       CDS       T04555                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
suam  Sulfitobacter sp. AM1-D1
Brite
KEGG Orthology (KO) [BR:suam00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BOO69_03640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: APE42611
UniProt: A0A1J0WE80
Position
complement(746493..747974)
Genome map
AA seq 493 aa AA seqDB search
MSTGPKGSQWKTLDTDLNRISQVELATAYVSRPLVAPGIALAFMVVAGIVAGVFFGQTST
SFVVIAAAVFGAYMAVNIGANDVANNMGPAVGANALTMGGAILIAALCESAGALLAGGDV
VSTISKGIIDPASIADTRIFIWAMMAALISSALWVNLATWVGAPVSTTHSVVGGVMGAGI
AAAGMTAVNWPSMSMIAASWVISPVLGGTVAAAFLAFIKARILYREDKIAASRTWVPVLV
GIMAGVFAAYLALKGLNKVISIDMPTALLIGLVLGVATYAISSPLIRRRSEGMENRNKSV
KVLFGLPLVFSAALLSFAHGANDVANAVGPLAAIVHASQFGGFEAQVNIPLWVMIIGAFG
ISFGLFLFGPKLIRMVGSQITKLNPMRAYCVALSAAITVIIASWLGLPVSSTHIAVGGVF
GVGFYREWHMERRLRRPDVAVGTVKRIAPEERRRRKLVRRSHFMTIIAAWVITVPAAASI
SAVVFLVLNAVVN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggaccgaagggcagccagtggaaaacgctggacaccgatctcaaccgtatt
tcccaagtcgaacttgcgaccgcctacgtgtcgcgccccctcgtcgcgccgggtatcgcg
ctggccttcatggtggtcgcggggatcgttgccggggtcttcttcggccagacctcgacc
agtttcgtggtgatcgccgcagcggtgttcggcgcctacatggcggtgaacataggggcc
aacgacgttgccaacaacatgggccccgcggtgggggccaacgcgctgaccatgggcggc
gccatcctgatcgccgccctttgcgaaagcgcgggcgccctgctggccgggggtgacgtg
gtgtcgaccatatccaaggggatcatcgatcccgcgtcgatcgccgatacaaggatattc
atctgggcgatgatggcggcgctgatctcgtcggccctgtgggtcaacctcgccacatgg
gtcggcgcccccgtctcgaccacccattcggtcgtcggcggcgtgatgggcgcgggcatc
gcggcggcaggcatgacggcggtgaactggccgtccatgagcatgatcgccgcaagctgg
gtgatctcgccggtgctcggcggcacggtcgccgccgccttcctcgccttcatcaaggcg
cgcatcctctatcgggaagacaagatcgccgcgtcgcgcacatgggtgccggtgctggtg
ggcatcatggcaggtgtctttgccgcttaccttgcgctgaaagggctgaacaaggtcatt
tccatcgacatgcccaccgcgctgctcatcggtctggtgctgggggtggcgacctatgcg
atctcctcgccgctgatccggcgcaggtccgaaggcatggagaaccgcaacaagtcggtg
aaggtccttttcggcctgccgctggtgttctccgccgcgctgctgagtttcgcccacggt
gccaacgacgtcgcgaacgccgtgggcccgctggccgcgatcgttcacgccagccagttc
ggcggtttcgaggcgcaggtgaacatccctctctgggtgatgatcatcggcgccttcggc
atctccttcggcctgttcctctttgggccaaagctgatccggatggtcggcagccagatc
accaagctcaatcccatgcgcgcctactgcgtcgcgctgtcggccgcgatcaccgtcatc
atcgcctcctggctaggtctgccggtgagttccacccacatcgcggtcggcggcgtcttc
ggcgtcggcttctatcgcgaatggcacatggagcggcgcctgcgccggcccgatgtggcc
gtcggcaccgtcaagcgcatcgcccccgaggaacgccgccgccggaaactggtgcgccgg
tcgcacttcatgaccatcatcgccgcatgggtcatcaccgtgccagcggccgcctcgatc
tcggcggtggtctttctcgtgctcaacgcggtggtgaactga

DBGET integrated database retrieval system