KEGG   Sulfitobacter sp. AM1-D1: BOO69_03985Help
Entry
BOO69_03985       CDS       T04555                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam00260  Glycine, serine and threonine metabolism
suam01100  Metabolic pathways
suam01110  Biosynthesis of secondary metabolites
suam01120  Microbial metabolism in diverse environments
suam01130  Biosynthesis of antibiotics
suam01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BOO69_03985
Enzymes [BR:suam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BOO69_03985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Pyridoxal_deC DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: APE42674
UniProt: A0A1J0WED1
Position
complement(815838..816872)
Genome map
AA seq 344 aa AA seqDB search
MFFSSDNAGPVHPQIMERIVADNAGHQMPYGNDTIMPEVRDRLREIFEAPEAAVYLVATG
TAANVLALACYTQPWQTIFCSKVAHVQMDECNAPEFYTGAAKLTLIETDSKMDPSKLEAA
IKGQKPGNVHGAQPGPVSITQVTERGSVYSLEELRALTAVAKAHDLPVHMDGARFANALV
ALDCTPAEMTWKSGVDVVSFGGTKNGCMGVEAVIFFDPAKAWEFELRRKRGAHLFSKHRY
LSSQMAGYLANDLWLTMARRANDNAARLADGLRKAGATFLHEPQANMIFASWPRAVHRKL
HEAGARYYLSGGTLDGPDAEPIGARLVCDWSVQAEDVDAFLSHF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcagctctgacaacgcggggcccgtgcatccgcagatcatggagcggatcgtc
gcggacaatgccggacaccagatgccctacggcaatgacacgatcatgcccgaggtccgc
gaccggctgcgcgagatcttcgaggcgccggaagcggcggtctatctggtggcgacggga
acggcggcgaacgtgctggcgctggcctgctacacgcagccctggcagacgatattctgt
tccaaggtcgcgcatgtccagatggacgaatgcaacgcgcctgagttctataccggtgcg
gcgaagctgacgctgatcgaaaccgacagcaagatggatccgtccaaactcgaagcggcg
atcaagggccagaagcccggcaacgtccacggcgcccagcccggcccggtgtcgatcacg
caggtgacggagcgcgggtcggtctacagcctcgaagagctgcgtgcgctgacagcggtg
gccaaggcgcacgacctgcccgtgcatatggacggcgcgcgtttcgccaatgcgctggtc
gcgcttgactgcacgccggcagagatgacgtggaaatccggtgtggacgtggtcagcttt
ggcggcaccaagaacggctgcatgggcgtggaggcggtgatcttcttcgacccggccaag
gcgtgggagttcgagttgcggcgcaagcgcggcgcgcacctgttttccaagcaccgctac
ctgtcttcgcagatggcgggctatcttgccaacgacctgtggctcacgatggcccggcgc
gcgaacgacaacgccgcccggcttgcagacggtctgcgcaaggcaggggcgacattcctg
cacgaaccgcaggccaacatgatctttgccagctggccccgtgccgtccatcgcaagctg
cacgaggccggtgcgcggtactacctttccggtggcacgctggacggcccggacgcggag
cccatcggcgcgcgactggtctgcgactggtcggtgcaggccgaggacgtggacgcgttt
ctgagccacttctga

DBGET integrated database retrieval system