KEGG   Sulfitobacter sp. AM1-D1: BOO69_09395Help
Entry
BOO69_09395       CDS       T04555                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam00220  Arginine biosynthesis
suam00330  Arginine and proline metabolism
suam01100  Metabolic pathways
suam01110  Biosynthesis of secondary metabolites
suam01130  Biosynthesis of antibiotics
suam01230  Biosynthesis of amino acids
Module
suam_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:suam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BOO69_09395
   00330 Arginine and proline metabolism
    BOO69_09395
Enzymes [BR:suam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BOO69_09395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: APE43602
UniProt: A0A1J0WH14
Position
1933369..1934289
Genome map
AA seq 306 aa AA seqDB search
MSTMNCILVGAPMDSGKRSKGCLMGPDAYRTAGLPQALRDLGHSVEDRGNVAPAPFTPKP
HPKLVALEETIAWTQSLADASEAAMRDGLPIFLGGDHALSLGTVLGAMRHAEAEGRPLFV
LWLDAHSDFHTPETTDSGNLHGTPLGYVTGRAGFDGFPPVGTPLPQQNVAIIGLRSVDAA
ERAALQDSDISHVDMREIDETGIARPLQAFLDRVEAANGLLHVSLDVDFLDPAVAPAVGT
TVPGGATVREGHLVMEMLHDSGLMTSLDLVELNPFLDERGKTATLMVDLAASALGRRVFD
RPNRAY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgatgaactgcattctggtcggggcaccgatggattcgggaaagcgcagcaag
gggtgcctgatgggccccgacgcctatcgcaccgcgggactgccgcaggcgctgcgcgat
ctcggtcacagcgtggaggatcggggcaacgtcgcccctgccccgttcacgccgaaaccg
caccccaagctggtggcgctcgaagaaacgatcgcctggacccaaagcctcgccgatgcg
tccgaggccgcgatgcgcgacgggctgccgattttcctgggcggggaccacgcgttgtcg
cttggcacggttctgggcgcgatgcgccatgccgaagccgagggacggccgctcttcgtc
ctctggctggacgcccacagcgacttccatacgcccgagaccaccgacagcggcaacctg
cacggaacgccgctgggctatgtcaccgggcgggcgggctttgacgggttcccaccggtc
ggcacgccactgccgcagcagaacgtggcgatcatcggcttgcgatctgtcgatgcggcg
gaacgggcggccctgcaggacagcgacatcagccacgtcgacatgcgcgagatcgacgaa
accgggatcgcccgcccccttcaggcgtttctcgaccgggtggaggccgccaacggcctg
ctgcatgtctcgctcgacgtggattttctcgaccccgccgtggcgcctgcggtcgggacc
accgtgccgggcggcgccaccgtgcgcgagggccatctcgtcatggaaatgctgcacgac
agcgggctgatgacgtcgctcgaccttgtggagctgaacccctttctcgacgagcgcggc
aagacggcgactctgatggtggatctcgccgcctcggcgcttggccgccgcgtcttcgat
cgtcccaaccgcgcatattga

DBGET integrated database retrieval system