KEGG   Sulfitobacter sp. AM1-D1: BOO69_13755Help
Entry
BOO69_13755       CDS       T04555                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam00020  Citrate cycle (TCA cycle)
suam00310  Lysine degradation
suam00380  Tryptophan metabolism
suam01100  Metabolic pathways
suam01110  Biosynthesis of secondary metabolites
suam01120  Microbial metabolism in diverse environments
suam01130  Biosynthesis of antibiotics
suam01200  Carbon metabolism
Module
suam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOO69_13755
  09105 Amino acid metabolism
   00310 Lysine degradation
    BOO69_13755
   00380 Tryptophan metabolism
    BOO69_13755
Enzymes [BR:suam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BOO69_13755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: APE44349
UniProt: A0A1J0WJ72
Position
2802175..2803752
Genome map
AA seq 525 aa AA seqDB search
MTEVRVPTLGESVTEATVATWFKKPGDTVAVDEMLCELETDKVTVEVPSPVAGTLSEIVA
DEGETVGVDALLANISEGDEGSKDAPKGKEAAKDDDAESGAERTQDAPKSIDAGAEEMKP
RDAADDIDVMVPTLGESVTEATVSTWFKQVGDTVAQDEMLCELETDKVSVEVPAPAAGTL
TQILAEEGSTVEANGKLAVISGGEGASASAPAQESAPPPAAADGKSGKDVEDAPSAKKAM
AENNISRDAVTGTGRDGRVMKEDVAKAIAAGSSAASAPEAKSAPRAPSSADDAAREERVK
MTRLRQTIARRLKEAQNTAAMLTTYNEVDMTAIMELRDEYKALFEKKHGVKLGFMSFFTK
ACCHALNEVPDVNAEIDGTDVVYKNYVHMGIAVGTPTGLVVPVVKNADAMSFAEIEKTIN
SLGAKARDGKLSMADMQGGTFTISNGGVYGSLMSSPILNPPQSGILGMHKIQDRAMVVNG
EIVVRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLMDL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtacgtgtgcccaccctgggcgaatccgtcaccgaagcgaccgtcgcgacc
tggttcaagaagccgggcgacaccgtggcggtggacgaaatgctctgcgagctggaaacc
gacaaggtcactgtcgaagtgccgagcccggtggcgggcaccctgtccgagatcgtcgcg
gacgaaggcgaaaccgtgggcgtcgacgccctgctcgccaacatctcggaaggcgacgaa
gggtccaaggacgcacccaagggcaaggaagccgccaaggacgatgacgccgagtcgggc
gcggagcggacccaggacgcgccgaaatccatcgatgcgggcgccgaggagatgaagccc
cgcgacgccgccgacgacatcgacgtcatggttcccaccctgggcgaaagcgtgaccgaa
gccaccgtcagcacatggttcaagcaggtgggcgacaccgtcgcacaggacgagatgctc
tgcgagttggaaaccgacaaggtcagcgtggaagtgcccgcgcccgccgccggcaccctg
acccagatcctcgccgaggaaggcagcaccgtcgaggcgaacggcaagctggccgtgatc
tcgggcggtgaaggcgcctccgcctccgcccccgcacaggaaagcgcgccgccccccgcc
gccgccgacggcaagagcggcaaggatgtcgaggacgcgccatcggccaagaaggcgatg
gccgagaacaacatcagccgcgatgcggtcacgggcaccgggcgcgacggtcgcgtgatg
aaggaagacgtggccaaggcgatcgcggcgggcagttccgccgcctcggcgccggaagcc
aaatccgccccccgcgccccctccagcgccgatgacgcggcccgcgaggaacgggtcaag
atgacccgcctgcgccagaccatcgcgcgccgcctgaaggaagcgcagaacaccgccgcg
atgctcaccacctacaacgaggtggacatgacggcgatcatggaactgcgcgacgagtac
aaggccctgttcgagaagaagcacggggtgaagctgggcttcatgtccttcttcaccaag
gcctgctgccacgcgctgaacgaggtgcccgacgtcaacgccgagatcgacgggaccgac
gtggtctacaagaactacgtccacatgggcatcgcggtgggcacgccgaccggccttgtc
gtcccggtggtcaagaacgccgacgccatgtcctttgccgagatcgaaaagacgatcaac
agcctcggcgccaaggcccgcgacggcaagctgtcgatggccgacatgcagggcggcacc
ttcaccatctcaaacggcggcgtctacggctcgctcatgtcctcgcccatcctgaacccg
ccgcagtcgggcatcctgggcatgcacaagatccaggaccgcgcgatggtggtgaacggc
gaaatcgtcgtgcgcccgatgatgtacctcgccctcagctacgaccaccgcatcgtcgac
ggcaagggcgccgtgacgttcctcgtgcgggtcaaggaagcgctggaagacccccggcgc
ctgctgatggacctgtaa

DBGET integrated database retrieval system