KEGG   Sulfitobacter sp. AM1-D1: BOO69_15075Help
Entry
BOO69_15075       CDS       T04555                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam00071  Fatty acid degradation
suam00072  Synthesis and degradation of ketone bodies
suam00280  Valine, leucine and isoleucine degradation
suam00310  Lysine degradation
suam00362  Benzoate degradation
suam00380  Tryptophan metabolism
suam00620  Pyruvate metabolism
suam00630  Glyoxylate and dicarboxylate metabolism
suam00640  Propanoate metabolism
suam00650  Butanoate metabolism
suam00900  Terpenoid backbone biosynthesis
suam01100  Metabolic pathways
suam01110  Biosynthesis of secondary metabolites
suam01120  Microbial metabolism in diverse environments
suam01130  Biosynthesis of antibiotics
suam01200  Carbon metabolism
suam01212  Fatty acid metabolism
suam02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BOO69_15075
   00630 Glyoxylate and dicarboxylate metabolism
    BOO69_15075
   00640 Propanoate metabolism
    BOO69_15075
   00650 Butanoate metabolism
    BOO69_15075
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BOO69_15075
   00072 Synthesis and degradation of ketone bodies
    BOO69_15075
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BOO69_15075
   00310 Lysine degradation
    BOO69_15075
   00380 Tryptophan metabolism
    BOO69_15075
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BOO69_15075
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BOO69_15075
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BOO69_15075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suam04147]
    BOO69_15075
Enzymes [BR:suam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BOO69_15075
Exosome [BR:suam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BOO69_15075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: APE44587
UniProt: A0A1J0WJV7
Position
3094182..3095480
Genome map
AA seq 432 aa AA seqDB search
MSVRNRQRVFLVDGARTPFLKARGAPGPFTPVDLAVQAGRPLLARQPFDRTAFDLVILGC
VNVIADEMNPARVAALRLGLGEAMVAFTMQINCGSGMQSIDTAYRYIREGSHQMILAGGT
EALSHAPLTLRQSAVEWFGKMNAAKGPLEQAKAMTGIRPEFFKPVVGLERGLTDPITTLN
MGQTAEVLAHRFGIDRKSADTYAMQSHHRLAAAQKEGRLNDEVMPAFDRDGQVYDHDDGV
RPDSDLEGLAKPKPVFEPPYGKVTAGNASQITDGASWCILASEKAVEAHGLEPLAEITDS
EWAALDPAIMGLGPVLSATPIMQRHDLKREDIGLWELNEAFAAQVLSCLAAWNDEDFCRE
VLGYDSAFGMIDRDRLNVDGGAISLGHPVGTSGNRIVLHLANAMKARGEKRGIATECIGG
GLGGAMMLEAVQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaggaaccgacaacgtgtctttctcgtcgatggcgcacgcacgccgttcctc
aaggcgcgcggtgcgccgggccccttcacgccggtcgatctggcggttcaggccggccgc
ccgctcttggcgcgtcagcccttcgaccggacagctttcgatctggtaatccttggctgc
gtgaacgtcatcgcggacgagatgaacccggcccgtgtcgcggcgctgcgcctcggcctg
ggcgaggcgatggtcgcctttaccatgcagatcaactgcggttccggcatgcaaagcatc
gacaccgcctaccgctatatccgcgagggaagccaccagatgatcctggccggcgggacg
gaggcactgagccatgcgccgctgaccttgcgccagtcggcggtggagtggttcggcaag
atgaacgccgccaagggccctctcgaacaggccaaggcgatgacgggcatccggcccgag
ttcttcaaacccgtcgtgggcctggaacgcggtctgaccgatccgatcaccacgctgaac
atgggccagaccgcggaggtgctggcgcatcgtttcggcatcgaccgcaagtcggccgac
acctatgcgatgcaaagccatcatcgtcttgccgccgctcagaaggaaggtcgtctgaat
gacgaggtcatgcccgcgttcgacagggatggacaggtttacgaccatgacgatggcgtg
cgccccgatagcgacctcgaaggtctggccaagcccaaaccggtattcgaaccgccctac
ggcaaggtgacggcgggcaatgcgagccagatcaccgacggcgcaagctggtgcatcctc
gcatccgaaaaggcggtggaggcgcacgggctcgaaccgctggccgaaatcaccgacagc
gaatgggcggcgctcgacccggcgatcatgggtctggggccggtcctgtccgcgaccccc
atcatgcagcggcacgacctgaaacgggaggacatcggcctttgggaactcaacgaagcc
ttcgccgcgcaggtgctttcctgccttgcagcatggaacgacgaggatttctgccgcgag
gtgctgggctatgacagcgccttcgggatgatcgaccgcgatcggctgaacgtggatggc
ggcgcgatctctcttggccacccggtgggcaccagcgggaaccgcatcgtgctgcatctt
gccaacgcgatgaaggcgcggggcgagaaacggggcattgcaaccgaatgcatcggcggc
gggcttggcggtgcgatgatgctggaggccgtgcaatga

DBGET integrated database retrieval system